KEGG   Chryseobacterium sp. 3008163: EAG08_08950Help
Entry
EAG08_08950       CDS       T05679                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00564  Glycerophospholipid metabolism
chrs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAG08_08950
Enzymes [BR:chrs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EAG08_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 Pyr_redox_3 NAD_binding_8 Pyr_redox_2 FAD_binding_3 HI0933_like Regulator_TrmB
Motif
Other DBs
NCBI-ProteinID: AYN00427
UniProt: A0A3G2G6N6
LinkDB All DBs
Position
1954411..1956000
Genome map
AA seq 529 aa AA seqDB search
MKRNEELSKLTSIKEWDFLIIGGGASGLGSALDATSRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAKNAAHVVKNQSFIIPNYTWWGGIYYKIGLSIYD
FLAGKLSLGRTQYISKSKTVEKLPTIQQKGLASGVVYQDGQFDDARLAINLTQTIIEKGG
TAVNYVKVINLIKNDSNKITGVVAEDQFTKQQFEIKAKVVINATGVFTNDILNMNNPKHG
KFVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLENESFEP
RALEEEINFVLNTARQYLSKKPTREDVKSVFAGLRPLAAPKDGSKSTKEVSRSHKVVTSD
TGLISIIGGKWTTYRKMAEDTIDEALKVHNLGITTSKTEHLSIHGNVKSETVDRTNHLYV
YGSDIPEIKKLQQNNPEFSEKIHPDHPFTIAEAVWAIRNEMAQTIEDILARRVRLLFLDA
RAAIDSAHKIAFIIAKENGHSAEWANEQENEFIELARGYLLTPYSPRNI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacgaagaacttagcaaattaacctccataaaagagtgggactttctaatc
atcggtggaggagcgagtggtttaggttcggcattggacgctacaagcagaggatttaaa
accttactgttagaatcacacgatttcgcaaaggcgacttccagcagaagtacaaaattg
gtacacggaggagtaagatatttagcacagggagatataggtttagtaaaagaagctttg
aaagaaagaggtctactcgccaaaaatgcagctcatgtggttaaaaaccagtcttttatt
attccaaattacacttggtggggaggaatttattataaaataggactttcgatttacgat
ttccttgcaggaaaactaagtttaggaagaacacaatacatcagcaaatcaaaaaccgta
gaaaaacttccaacaattcagcaaaaaggtttggcaagcggagttgtttatcaggacgga
cagttcgatgatgcaagactggcgattaatttaacgcaaaccattattgaaaaaggagga
actgccgttaattatgttaaagttattaatttaattaaaaatgattccaataaaataaca
ggtgtagttgcagaagatcagttcacgaaacagcaattcgaaattaaagcgaaagtggtc
atcaatgcaaccggagtttttacgaatgatatcttaaatatgaataacccgaaacacgga
aaatttgtagttccaagtcagggaattcatttggttttggataaatctttcttaaaaagt
gacgacgccattatgattcctaaaacttcagacggaagagtcttgtttgtcgttccttgg
cacgacagagctttagtcgggacaactgatactttactggaaaacgaaagtttcgaaccg
agagctttggaagaagaaattaatttcgttttaaatacagcaagacaatatttatctaaa
aagccaacccgtgaagatgtaaaatctgttttcgctggacttcgaccccttgccgctcca
aaagacggaagcaaaagcacaaaagaagtttcccgaagtcataaagtggttacatccgac
accggattgatttccattatcggtggaaaatggacaacgtaccgtaaaatggcagaagac
acgatcgatgaagcattaaaagttcacaacttaggaattacaacttccaaaacagagcat
ctttcgattcatggaaatgtaaaatctgaaactgttgacagaaccaatcatttatatgta
tatggttcagacattcctgaaatcaaaaaattacaacaaaacaatcctgaattttcagaa
aaaatacatcctgatcatcctttcacaatagcagaagcagtttgggcaattcgaaacgaa
atggcgcagactattgaagatattttggcaagaagagtccgtcttttatttttggatgca
agagcagcgatcgacagtgcacataaaatcgcttttattattgcaaaagaaaacggacat
tctgcagaatgggcaaacgaacaggaaaacgagtttatcgaattggcgagaggatattta
ctgactccttattcgccaagaaacatctaa

DBGET integrated database retrieval system