KEGG   Chryseobacterium sp. 3008163: EAG08_20025Help
Entry
EAG08_20025       CDS       T05679                                 

Definition
(GenBank) F0F1 ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00190  Oxidative phosphorylation
chrs01100  Metabolic pathways
Module
chrs_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EAG08_20025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:chrs00194]
    EAG08_20025
Photosynthesis proteins [BR:chrs00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   EAG08_20025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N
Motif
Other DBs
NCBI-ProteinID: AYN02285
UniProt: A0A3G2GC34
LinkDB All DBs
Position
4272765..4273046
Genome map
AA seq 93 aa AA seqDB search
MNIKILTPEYVVFEGEVNSVLLPGKNGEFHIMKNHAGIVSSLVGGKVKLYANSINEAFAK
NFTKENEKDSVFSYPIKSGVIEFNHDKGIILCE
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaaattttaacaccagaatacgtagtttttgaaggagaggtaaactctgta
ttgttgcctggaaaaaatggtgaattccacatcatgaaaaaccacgcaggaatcgtttct
tcattagttggaggtaaagttaaattgtatgcaaattctatcaacgaagcttttgctaaa
aactttactaaagaaaatgaaaaagactctgttttttcttatcctataaaaagcggtgtg
atagaatttaatcacgataaaggaattatcctttgcgaataa

DBGET integrated database retrieval system