KEGG   Chryseobacterium sp. 3008163: EAG08_20195Help
Entry
EAG08_20195       CDS       T05679                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00010  Glycolysis / Gluconeogenesis
chrs00020  Citrate cycle (TCA cycle)
chrs00620  Pyruvate metabolism
chrs01100  Metabolic pathways
chrs01110  Biosynthesis of secondary metabolites
chrs01120  Microbial metabolism in diverse environments
chrs01130  Biosynthesis of antibiotics
chrs01200  Carbon metabolism
Module
chrs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAG08_20195
   00020 Citrate cycle (TCA cycle)
    EAG08_20195
   00620 Pyruvate metabolism
    EAG08_20195
Enzymes [BR:chrs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EAG08_20195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: AYN02313
UniProt: A0A3G2GCN3
LinkDB All DBs
Position
4312602..4314218
Genome map
AA seq 538 aa AA seqDB search
MAEVITMPRLSDTMTEGKVAKWHKKVGDKIKEGDILAEIETDKAVQDFESEIEGTLLFVG
VEEGAAAAVDSILAIIGQEGEDISSLKGGNAPAAEGASEEKKSEEESKTENESTSVEQTS
AEVPAGVEVITMPRLSDTMTEGKVAKWHKNVGDTVKEGDLLAEIETDKAVQDFESEFNGV
LLKQGVEEGGAAPVDSVLAIIGPEGTDVSGVGAAKPATKSEDKPAEQKSAAKAEEKSVAQ
TANTSSSDRVAISPLAKKIAQDKGVDINSLQGSGENGRIVKKDIENYQPSQKSEAAPAQN
NAAAQVALSFVQGEDTETPNSQVRNIIAKRLAESKFSAPHYYLMVEINMDKAIEARKEIN
SLPDTKISFNDMIIKATAVALRKHPQVNSSWAGDKVIHRGNINVGVAVAIPDGLVVPVLK
NTDQMNYTQISAAVKDMAGRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNAAI
LSVGAIVEKPIVKDGQIVVGNLMKLSLACDHRVVDGATGAQFLQTLKTYLESPLTLLL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttattacaatgccacgtctttccgacacgatgacggaaggtaaggtggcg
aaatggcataaaaaagtaggagataaaataaaggaaggagatattttagctgaaattgaa
acagataaagcggttcaggatttcgaatctgaaattgaaggaactcttttatttgtagga
gttgaagaaggtgctgctgcggcagttgattctattttagcaattatcggtcaagaaggt
gaagatatttcttctttaaaaggaggaaatgctccggcggctgaaggtgcttctgaagag
aaaaaatctgaagaagaatctaaaactgaaaacgaatctacaagcgttgagcaaacttca
gctgaagttcctgcaggagtagaagtaattacaatgccaagactttctgatacaatgaca
gaaggtaaggtagctaaatggcacaaaaacgttggagatacagtaaaagaaggagactta
cttgctgagatcgaaacagataaagcagttcaggattttgaatctgaattcaatggagtt
cttctaaaacaaggtgttgaagaaggcggagctgcaccagttgacagtgttttggcaatt
atcggccctgaaggaactgatgtttcaggagttggagctgcaaaaccggcaacaaaatct
gaagacaaaccagctgagcaaaaatctgcagcgaaagcagaagagaaatcggttgcacaa
actgcaaatacttcttcatcggacagagtagctatttctcctttagctaaaaaaatagct
caggataaaggcgttgacatcaacagtcttcaaggttctggtgaaaacggaagaattgtg
aaaaaagatattgaaaactatcagccttcacaaaaatctgaagctgctccggcacaaaat
aatgctgctgctcaggttgctttaagctttgtacagggagaagatacagaaactccaaac
tctcaggtaagaaatatcattgcgaaacgtcttgctgaaagtaagttctctgctcctcac
tattatctaatggttgaaatcaacatggataaagcgattgaggcaagaaaagaaatcaac
tcattaccagatactaaaatttcattcaacgatatgattattaaggcgacagcagttgct
ttaagaaaacatccgcaggtgaactcaagctgggcaggagataaagtaattcacagagga
aacatcaatgttggagtagcagttgcgattcctgacggattggtagttccggttctaaag
aatacagaccaaatgaattacactcagatttctgctgctgtgaaagatatggctggaaga
gcaaaatctaaaggtcttaaagcaaacgaaatggaagggtctacattctctatctcaaac
ttaggaatgttcggaattgaaacctttacaagtattatcaatcaaccaaatgctgcaatt
ctttcagtaggtgctattgttgagaaaccaatcgtaaaagatggtcaaattgtagtaggg
aatcttatgaaactttcattagcgtgtgaccacagagtagttgatggtgctacgggagct
cagttcttgcagacattaaaaacatatttagaaagtccattaacattgttactgtaa

DBGET integrated database retrieval system