KEGG   Chryseobacterium sp. T16E-39: CEY12_00245Help
Entry
CEY12_00245       CDS       T04952                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00620  Pyruvate metabolism
chry00680  Methane metabolism
chry01100  Metabolic pathways
chry01120  Microbial metabolism in diverse environments
chry01200  Carbon metabolism
Module
chry_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEY12_00245
  09102 Energy metabolism
   00680 Methane metabolism
    CEY12_00245
Enzymes [BR:chry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CEY12_00245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3437
Motif
Other DBs
NCBI-ProteinID: ASK28630
UniProt: A0A220S5A8
LinkDB All DBs
Position
57518..60052
Genome map
AA seq 844 aa AA seqDB search
MIHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESKNGYEAGKTPEEI
VEDFFKSHTDLHTEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDNGTVTNLFE
RSQQDHKLEKVREKLRDFTVKVVFTAHPTQFYPSSVQRIIQDLRSAITTDSVTNIDMLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRYVYYDTIGELFTKIRKTFGNGHFHLHEDIIQLG
FWPGGDRDGNPFVTADVTKRVAEELRSAILKSYYSHLKYIRRRLSFRGVSEVLQQLNDEL
YAAIFNNHKITTEDILKRADKAEHILVKEHNSLFLELLMNFKDRVKIFGTHFATLDIRQD
SRIHQQVIDEVFAKVYGNVEADHNEKFNKLIQITDRVNADDFEGIVKDTLLTVSEITEIQ
QLNGLRGMNRYIISNSDAVKDVMNVYAFFKICGYKEEDINMDIVPLFETMEGLDNAENVM
KELYENPVYKKHLEKRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKEALTKLSEESGIKV
VFFDGRGGPPARGGGKTHDFYASQGNTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNSKKDFTEKERKLITELAEISYKKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGNGNELKFEDLRAIPFVGSWSQLKQNVPGFFGFGFAMEEMKKQGRFEEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKNNPKFGAFWNVLFEEYSLSKDIMLELTGF
TMLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatacatgaccaacgcgcagagaaattcaggcaaattgtagaaaataagtttcagatc
tacaactctttatttatgagtttgccttatgataaaatgacgaatatcgggatgctactc
ccgtttttatatgaggaaagtaaaaatggttacgaagccggaaagactcccgaagaaatt
gtagaggatttttttaaaagccataccgatttacatacggaagaacaaaaacttgaattg
ctttttaagatcatacaatatatcgaaaggcaggtggttttattcgacagtattgaagat
gctgcttttcctaatcttcactctgaaagcgataacgggacagtaacgaatctttttgag
cgttcccaacaggatcataaacttgaaaaagtccgggaaaaattaagggattttactgtt
aaggttgtttttactgctcaccctacacaattctatccaagttctgttcaaagaatcatt
caggatttaaggtcggcgattactacagattctgtaacgaatattgacatgttattacag
cagttaggcaaaacaccatttgttaataaagagaaaccaacaccgattgatgaggcatta
agtatcatttcttatttgcgatatgtgtattatgatacgatcggtgagttatttaccaag
atcagaaaaacttttggaaacggacattttcatttgcatgaagatatcatccagcttggc
ttctggcctggaggtgacagagatggaaatccttttgtaacggctgatgttaccaaaaga
gtagccgaggaacttcgttctgcaattttaaaatcttattacagccatttgaagtatatc
aggagacgtttaagtttcagaggggtgtcagaagtactgcagcaacttaatgatgaacta
tatgcagccattttcaataatcataagatcaccactgaagatattctgaaaagagcggac
aaagcggaacatattcttgtaaaagagcataattcattgtttttagagctgctaatgaat
ttcaaggatcgtgttaagattttcggaacccatttcgcaacccttgatattcgtcaggac
agcaggattcatcagcaggttattgatgaggtttttgctaaagtgtatgggaatgtcgaa
gctgatcacaacgaaaaatttaataaattaattcaaatcacagatagagtaaatgctgat
gattttgaaggaattgtaaaagatactttacttacagtttcagagattactgaaattcag
caattgaatggattgcgagggatgaaccgatacattatctctaattctgatgctgtaaaa
gatgtgatgaatgtatatgcattttttaaaatctgtggttataaggaagaagacatcaat
atggatattgtcccattgtttgaaaccatggaagggcttgataatgctgaaaatgtaatg
aaggagctttatgaaaaccctgtttacaagaaacatcttgaaaaaagagggaaccagcaa
accattatgcttggtttttctgacggaacaaaagatggaggatatttaaaagccaactgg
gagatttataaagctaaagaggcgttgaccaaactttctgaagaaagcgggatcaaagtt
gttttctttgatggtagaggcggaccacctgcgagaggaggaggtaagacccatgacttc
tatgcttctcaaggaaacactatcgccaataataaaattgaactaacgatccagggtcaa
acaatcaccagtatttttgggaataaagaacaggcaaaatataattttgagcaacttctt
acagcaggagtagaaaatgatgtctttaaaaattctaaaaaagatttcactgagaaagaa
aggaaactcattacagaattggctgaaatcagttataagaaatattcagatctgaaagca
catccgatgtttgttccctaccttcaggagatgagtacattggaatattacggtaaaaca
aatattggaagccggccatcaaaacgtggaaatggaaatgaattaaaatttgaagattta
agggctattccttttgtaggttcatggtcacagttgaaacaaaatgtgcccgggttcttt
ggttttggctttgccatggaagaaatgaagaaacagggaaggtttgaagaagtaagagaa
ttgtataagggatcagacttctttaaaactttagttttaaactctatgatgagtatgaat
aaatcttatttcccgcttacatactatatcaaaaacaatccgaaatttggagcattctgg
aatgtattgtttgaagaatatagcctttcaaaagatattatgctggaactaacgggattt
acaatgcttcaggaagaagacccattatcgagaaaatctgtgaaaatccgtgaaaagatc
gttttgccattattgagtatccagcaatatgctttaatgaaaatccagaaaggagaaggg
aataaagaagcttatgaaaagctggtaacccgatcattgtttggaaatattaatgcgagt
agaaactcagcttaa

DBGET integrated database retrieval system