KEGG   Chryseobacterium sp. T16E-39: CEY12_05130Help
Entry
CEY12_05130       CDS       T04952                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00020  Citrate cycle (TCA cycle)
chry00310  Lysine degradation
chry00380  Tryptophan metabolism
chry01100  Metabolic pathways
chry01110  Biosynthesis of secondary metabolites
chry01120  Microbial metabolism in diverse environments
chry01130  Biosynthesis of antibiotics
chry01200  Carbon metabolism
Module
chry_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chry_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chry00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEY12_05130
  Amino acid metabolism
   00310 Lysine degradation
    CEY12_05130
   00380 Tryptophan metabolism
    CEY12_05130
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CEY12_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASK29527
UniProt: A0A220S7V8
LinkDB All DBs
Position
complement(1162084..1164900)
Genome map
AA seq 938 aa AA seqDB search
MDRFSFLNAAHSQLIEDLYQQYLKFPDSLEPSWKAFFQGFDFALENYGDEDNIQYIQVPA
NAAPAVQQISQAVSNGEVPEHIKKEFKVVNLIEAYRTRGHLFTKTNPVRERRHYMPTLDI
ENFGLSKEDLNTKFNCAVETGMKEPATLQDIITHLEHIYCDSIGVEYTYINNVEEKDFIK
KWLQVNENHPSLSANEKTEILLKLNQAVAFENYLHTKFVGQKRFSLEGGETLIPALDQLI
SRSSQLGVDEVVLGMAHRGRLNVLSNIFGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSS
KRIKTASGEEVSINLTPNPSHLETVAALVEGICRAKVDDTYKGDYSKILPIIIHGDGAIA
GQGIVYEVAQMMTLEGYRTGGTVHIVVNNQVSFTTNYADARSSTYCTDIAKVTESPVMHV
NADDAEAVVHAIHFAADFRAKFGKDVYIDLLGYRKYGHNEGDEPRFTQPNLYKLISKHPN
PREIYKDKLIQDSIVSNDILKKMETDFKALLDKDFDASKEIEKNVMDVFMSEDWTNYPIA
ARGAMQSSVDTKYDLSKLKELAIKMSTLPADKKFINKITRLFENRVKAIEGNSLDWALGE
WLAYATLLTEGHNIRISGEDVERGTFSHRHAVVKTEDTEEEYIPLRHVSENRFDVYNSHL
SEYGVLGFDYGYAMVSPNTLTIWEAQFGDFVNGAQIIVDQYLAAAEEKWKIQNGLVMLLP
HGSEGQGAEHSSARLERFLTLCANENMVVANITSPANYFHLLRRQLKWTYRKPLIVMSPK
SLLRHPKVVSPLEDFATGAFQPILDDPTADPKKVEKVVLCSGKFYFELLAKKEELNAENI
ALVRFEQLYPLQADAIEQIFNKYENRKELIWAQEEPENMGAWSYILRNFRDTGIQVIAAV
PSAAPAPGSHKMFEKNQNAVINKVFNTNDAPTKRPVTV
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcattcctaaacgcagctcattctcagttaattgaggatttataccaa
caatacttaaaattcccggattctttagaaccatcatggaaagccttctttcaaggtttc
gattttgccttggaaaactacggtgatgaagataacatccaatacattcaagttccagct
aatgctgcccctgcagtacagcaaatatctcaggcggtatcaaacggagaggttcctgag
cacatcaagaaagaatttaaggttgtaaaccttattgaggcttacagaacaagagggcat
ttgtttacaaaaacaaacccggtaagagaaagaagacattatatgcctactttggacatc
gaaaatttcggtctgagcaaggaggatttaaatacgaaatttaactgtgctgttgaaaca
ggaatgaaagaacctgcaacgctacaggatattatcactcatttggagcacatctattgt
gattcaatcggtgttgaatatacttacatcaacaatgttgaagagaaagattttatcaaa
aaatggttacaggtaaacgaaaaccatccaagtctttcagctaatgaaaaaactgagatt
ttattaaagttgaatcaggctgtagcttttgaaaactatcttcataccaaatttgttggt
cagaaaagattctctctggaaggaggggaaacattaattcctgctttagaccagctaatt
tcaagatcttcccaacttggagttgatgaggttgttttagggatggctcacagaggaaga
ttaaatgtattatctaatatttttggaaaatcttacaagcagattttctctgaattcgaa
gggaaagaatttgaagaagatgttttctctggtgacgttaaatatcacttaggatcttct
aaaagaatcaaaacagcttctggagaagaagtttctattaacctaactccaaacccatca
cacttagaaacagtagctgccttagtagaagggatctgccgtgctaaagtagatgacacc
tataaaggagattattctaaaatcttacccattattatccatggagatggagctattgca
ggacaaggaattgtgtatgaagtagcacaaatgatgactttggaaggatatagaacagga
ggtacggtacatattgttgttaataaccaggtttcatttacgactaattatgcggatgca
agatcatctacatactgtacagacatcgcaaaagttactgaatctccggtaatgcacgtg
aatgcagatgatgctgaagcagtagtacacgctattcactttgctgccgatttcagagct
aagtttggaaaagatgtttatatcgacttattaggatatagaaaatatggtcataacgaa
ggggatgagccaagatttacacagcctaatttatataagctgatttctaagcatccaaat
ccaagagaaatctataaagataaattgattcaggacagtatcgtttctaatgatattctg
aagaaaatggaaactgatttcaaagctcttttagataaagactttgatgcttccaaagaa
atagagaaaaatgtaatggatgtgtttatgtctgaggactggactaattatccaattgca
gcaagaggtgctatgcagtcttcagttgatactaaatatgatttgtctaagttgaaagaa
ttggctattaaaatgtcaacacttcctgcggataagaaattcattaataagattacaaga
cttttcgaaaaccgtgtaaaagcaatcgaaggaaactctttagattgggctttaggagaa
tggttagcgtatgctacattgcttactgaaggtcataacatcagaatctccggagaagat
gtagaaagaggtactttctctcacagacacgcggtagtaaaaactgaagatactgaagaa
gaatatatcccattaagacatgtttctgaaaatagatttgatgtttataattctcatctt
tcagaatatggtgttttaggttttgattatggttatgccatggtttctccaaacacacta
acgatttgggaagcacagtttggggatttcgtaaacggagctcagattattgttgaccaa
tatttggctgctgctgaagaaaaatggaaaattcaaaatggtttagtaatgttattgcct
cacggttctgaaggacaaggagctgaacactcttctgcaagattggagagattccttact
ctttgtgccaacgaaaacatggtagtggctaatattacatcaccagctaactatttccac
ttactaagaagacagttgaaatggacttacagaaagccattgatcgtaatgagtcctaaa
tcattgttgagacatcctaaagtggtttctccattagaagattttgcaaccggagctttc
cagcctattttggatgatcctactgcagatcctaaaaaagtagaaaaagtggttctttgt
tcaggtaaattctatttcgaattactggctaagaaagaagaacttaatgctgaaaatatt
gcattagtaagatttgagcaattatatccgctacaagctgatgctattgaacaaattttc
aataagtatgaaaacagaaaagaattaatttgggctcaggaagaacctgaaaatatgggg
gcttggtcttacatcttaagaaatttcagagatacaggaattcaggtaatcgctgctgta
cctagcgctgctccggctccgggaagtcacaaaatgtttgaaaaaaatcaaaatgcggta
atcaacaaggtttttaataccaatgatgctccgacaaaaagacctgtaacggtttaa

DBGET integrated database retrieval system