KEGG   Chryseobacterium sp. T16E-39: CEY12_10440Help
Entry
CEY12_10440       CDS       T04952                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00500  Starch and sucrose metabolism
chry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CEY12_10440
Enzymes [BR:chry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CEY12_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ASK30499
UniProt: A0A220SAF8
LinkDB All DBs
Position
complement(2299345..2300778)
Genome map
AA seq 477 aa AA seqDB search
MKKTYFLFSIVALGVVNSCTTNDEITDKSSKDSEVHSKTIQVTHHDGRPFSTGKESVYNK
FVAGPGGGVLMQGFYWDVPEGGNWWNTVKDKLTNWSNAGIGAVWLPPASKAQNGAYSMGY
DPTDYYDFGNFNQNGSIETRFGSRTELEALITKAHAENMQVYADIVINHNSGGQSEANPY
TGTNTWTNFSGVASGKFTRNYNDFYKNAYGNNDEGAFGGFPDLCHANPYVQDWLWGRDDS
VGKYYKNVMKFDGWRFDYVKGFSAWVVNNWNSKVGGFSVGELWDSNVNTLESWANNANSS
VFDFAAYYKMDEAFDNGNLNVLNDDMMWKRNPYKAVTFVANHDTDIINNKMPAYAYILTH
EGYPTIFYRDYEEWLNKERLNNLIWIHNNKATGTTSILYTDNDEYIARRNGYNGNPGLVV
YINTSSSWQERWVDTNWSNQQIKDFTGASSWYPTTQADKRVKIQCPPNSYSVWSLNQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacatatttcttattttccattgtagcgttgggagttgtaaactcttgcaca
accaatgatgagataacggataagagctcaaaagactcagaggttcactctaaaacgata
caggttacccatcatgacggaagacctttcagtacaggaaaagagtctgtttataataaa
tttgtagctgggcccggaggtggagttttaatgcagggtttttattgggatgttcccgaa
gggggaaactggtggaataccgttaaagataaattgactaactggtccaatgcgggaata
ggagcagtctggttgcctcctgcctctaaagcacaaaatggtgcttattctatgggatat
gatcccactgattattacgactttggaaattttaatcaaaacggaagcattgaaacccga
tttggttcaagaacggaactggaagcattaattactaaagcccatgctgaaaatatgcag
gtatatgccgacattgtgatcaatcacaacagtggtgggcaatctgaagcgaatccctat
acaggaacaaacacatggaccaatttttcaggagttgcttccgggaagtttaccagaaat
tacaatgacttttacaagaatgcttacggaaataatgacgaaggtgcctttggaggtttt
ccggatttatgtcatgccaacccttatgttcaggattggctctggggaagagatgattct
gttgggaagtattataaaaacgtaatgaaatttgatggttggagatttgattatgtgaaa
ggatttagtgcctgggtggtgaataactggaattcgaaagtaggtggcttttccgtggga
gaattatgggactcgaatgtcaatacattagagtcctgggcaaataatgccaatagctcc
gtatttgattttgcagcttattataaaatggatgaagcttttgataacgggaatctcaat
gttttgaatgatgacatgatgtggaaaagaaatccttataaagcagtcacgtttgtagcg
aatcatgataccgatattatcaataataaaatgccagcctatgcctatattcttacccat
gagggctatccaactatattttacagagattatgaagaatggttgaataaggaaagatta
aataatctgatctggattcataataataaagctaccggaacaacttctattctgtatact
gataatgacgaatatattgccagaaggaatggatataacggtaatcctggtttggtcgtg
tatatcaatacttcttcaagctggcaggaaagatgggtagataccaattggagcaatcag
cagatcaaagattttacaggagcttcgagctggtacccaaccacgcaggctgacaaaaga
gtgaaaatccaatgtccgccgaatagctattctgtttggtcgctgaatcagtag

DBGET integrated database retrieval system