KEGG   Chryseobacterium sp. T16E-39: CEY12_12000Help
Entry
CEY12_12000       CDS       T04952                                 

Definition
(GenBank) 3'-phosphoesterase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:chry00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CEY12_12000
Enzymes [BR:chry01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEY12_12000
DNA repair and recombination proteins [BR:chry03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CEY12_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: ASK30790
UniProt: A0A220SBB7
LinkDB All DBs
Position
2656388..2656990
Genome map
AA seq 200 aa AA seqDB search
MALKDYNEKRKFNETSEPEGKTKKGKGQLIFVIQRHAASRLHYDFRLEMEGVLKSWAVPK
GPSLDPKDKRLAMMVEDHPYDYKDFEGNIPEGNYGAGQVEIWDSGTYEPLEQSTKLSAEK
ELLKELHAGSLKFVLHGKKLKGEFALVKMKNAEDNSWLLIKHKDDFAETGYDAEQNTSAK
SLVTQFLEEKKSLKSNKKKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaagattataacgagaaaaggaagttcaatgaaacgagtgaacctgagggc
aaaacaaaaaaaggcaaaggtcaacttatttttgttattcaaaggcatgccgcatcacgg
cttcactatgattttcgtttagaaatggaaggagttttaaaaagttgggctgtacccaaa
ggtccttctctggatcccaaagataaacgtctggcaatgatggttgaagaccatccctat
gattacaaagattttgaaggaaatattcctgagggaaattatggtgccggtcaggtagaa
atctgggatagtggaacgtacgaaccactggaacaaagcactaaactttctgctgaaaaa
gaattattgaaagaattgcatgcaggatcattaaaatttgttttacacggtaaaaaactg
aaaggtgaatttgctttggttaaaatgaaaaatgctgaagataattcgtggttgttgatc
aaacataaagatgattttgcagaaacgggttacgatgctgaacagaatacttctgcaaaa
tcattggtaactcagtttttagaggaaaaaaaaagcctaaaaagcaacaaaaagaagtca
taa

DBGET integrated database retrieval system