KEGG   Chryseobacterium sp. T16E-39: CEY12_16650Help
Entry
CEY12_16650       CDS       T04952                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chry  Chryseobacterium sp. T16E-39
Pathway
chry00564  Glycerophospholipid metabolism
chry01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CEY12_16650
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CEY12_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 NAD_binding_8 FAD_binding_3 Thi4 HI0933_like Pyr_redox_2 Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: ASK31641
UniProt: A0A220SDT9
LinkDB All DBs
Position
complement(3680743..3682332)
Genome map
AA seq 529 aa AA seqDB search
MKRNEELSKLTSVKEWDFLVIGGGASGLGSALDAVSRGFKTVLLESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAKNAAHVVKNQSFIIPNYTWWGGIYYKIGLSIYD
FLAGKLSLGKTKYISKSKTVEKLPTIEQKNLASGVVYQDGQFDDARLAVNLTQTIIEKGG
AAVNYVKVINLIKNDSDKVIGVIAEDQFTKQQFEIHAKVVINATGVFTNDILNMNNPKHG
KFVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLESESFEP
RALEEEVKFVLNTARQYLAKKPTREDVKSVYAGLRPLAAPKDGSKSTKEVSRSHKVITSD
TGLVSIIGGKWTTYRKMAEDTIDKAMQVHQLGTAASKTEHLSIHGNMKPEAVDRSSHLYV
YGSDIPEIKKLQQSNPEFSEKIHPDHPFTIAEAIWAIRNEMAQTIEDILARRVRLLFLDA
RAAIDSAHKIASIIAKENGHSQEWANEQEREFIELAKGYLLTPYSPRSI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacgaagaactcagcaaattaacctctgtaaaagaatgggactttttggtc
atcggtggaggagcaagcggtttaggttcggcattggatgcagtaagcagaggatttaaa
acagtactgttggaatctcacgattttgcgaaagcgacttccagcaggagtacaaaactg
gtacacggtggtgtacggtatttagcacagggagacatcggtttggtaaaggaagcttta
aaggaaagaggattgctggcaaaaaacgccgctcatgttgtaaaaaatcagtcttttatt
attccaaactatacttggtggggaggaatttattataaaatcgggctttcgatttatgat
ttcctagcgggaaaactaagtttaggaaaaacgaaatacatcagcaaatcaaaaacagtt
gagaaacttccaaccattgaacaaaaaaacctggcaagcggtgtcgtttatcaggatgga
cagtttgatgatgccagattagcagttaatttaacgcagacaattattgaaaaaggagga
gcagctgttaattatgttaaggtaatcaatttaattaaaaacgattctgataaagtaatc
ggtgtcattgcagaagatcagtttactaaacagcaatttgaaattcatgcaaaagttgtg
atcaacgcaaccggagtttttacgaacgacatcttaaatatgaataatccgaagcacgga
aaattcgtcgttccgagtcaggggatccatttggttttagataaatctttcttgaaaagt
gatgatgcgatcatgattccaaaaacttcagacggtagagttctatttgtcgttccttgg
cacgacagagctttagtgggaaccacggacactctattggaaagtgaaagctttgaaccc
cgtgcattggaagaagaagtgaaatttgtgctcaatacagcaagacaatatttagcaaaa
aaaccaacacgcgaagacgtaaaatcggtttacgcgggacttcgtccacttgccgctcct
aaagatggaagtaaaagtacgaaggaagtttcaagaagtcataaagtgataacatctgat
acaggattggtttctattatcggaggaaaatggaccacttaccgaaaaatggcagaggat
actatcgataaggccatgcaggttcaccaattgggaacagcagcttctaaaactgaacac
ctttcaattcacggaaatatgaaacctgaagcggttgacagaagcagccatttatatgtg
tacggttccgacattccggaaatcaaaaaactacaacaaagcaatcctgaattttcagaa
aaaatacatcctgatcatccatttaccattgctgaagcaatttgggcaatccgaaacgaa
atggcacagaccattgaggacatccttgcccgaagagtccgccttttatttttggatgcg
agagcagcgatcgacagtgcacacaagatcgcctctatcattgcaaaagaaaacggccat
tcacaagaatgggcaaatgaacaggaaagagagtttatcgaattggcgaaaggatattta
ctgactccttattcaccaagatctatttaa

DBGET integrated database retrieval system