KEGG   Chryseobacterium sp. 6424: CO230_03740Help
Entry
CO230_03740       CDS       T05704                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chrz  Chryseobacterium sp. 6424
Pathway
chrz00620  Pyruvate metabolism
chrz00680  Methane metabolism
chrz01100  Metabolic pathways
chrz01120  Microbial metabolism in diverse environments
chrz01200  Carbon metabolism
Module
chrz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CO230_03740
  09102 Energy metabolism
   00680 Methane metabolism
    CO230_03740
Enzymes [BR:chrz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CO230_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AYO57312
UniProt: A0A3G2TB36
LinkDB All DBs
Position
796512..799049
Genome map
AA seq 845 aa AA seqDB search
MQHHEITEKFRQLVENKFQIYNSLFMSLPYDRMTNIGMLLPFLYEESKAGYQLGKSPEEI
IEEFFIKHTGLQTEEQKTELLFKIIQYIERQVVLFDSIEDAAFSQLHPESESGTLLQLYE
RAMQDRRLDAVRKKMQDFSVRVVFTAHPTQFYPNAVQRILHDLRSAIMKDSVTDIDMLLQ
QLGKTPFLNREKPTPLDEALSIIFYLRYVYYDSIGELYRKIKNTFGKDHDQPNPNIFQLG
FWPGGDRDGNPFVTADITRKVAQQLHISILKSYYAHLKKLRRRLSFRGVSDELDMLSEEI
YSAVYDGRNISEKQILSRINNAEEILMTQHNGLFSNLLDDFKDRVTIFGTHFATLDIRQD
SRVHQQVIDEIVWRKAGFTHELTSEEKLHWLLSTHEVIRPEEFDEVTKDTLENIINIKTI
QQTNGERGMSRYIISNSDEVKDVLNVFAMFRLCGYAEEDIKMDIVPLFETMQGLDAAADV
MKSLYELPVYRRHLERRGNQQTIMLGFSDGTKDGGYLKANWEIYQTKEELTKRSEENGIN
VIFFDGRGGPPARGGGKTHDFYAAQGKTIANHKIEITIQGQTITSVFGNKDQAKYNFEQL
LTAGIESEVFKNDKKDIEPSERALIAELAELSFRKYTDLKSHPRFVPYLQEMSTLQYYGK
TNIGSRPTKRGADGDLKFEDLRAIPFVGSWSQLKQNVPGFFGFGFALNELKKQDRFDEIK
ALYRGSDFFKTLVLNSMMSMNKTYFPLTSYMKDNETYGEFWQILFDEYQLSKSMMLELTG
FKMLMEEEPLSRKSIKIREKIVLPLLSIQQYALMKLHKNEGNREAYEKLVMRSLFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaccacgaaattaccgagaaattcaggcaacttgtcgaaaataagttccaaatc
tataattcactgtttatgagtctgccttatgacagaatgacgaatatcggcatgctttta
ccatttctttatgaagaaagcaaggccggttatcagctggggaaaagccccgaagaaatt
atagaagaattcttcattaaacataccgggttacagacagaggaacaaaaaaccgaactc
ttgtttaagatcatacagtatattgaacgacaggttgttttgtttgacagtattgaagat
gctgctttttcgcagttacaccccgaaagcgaatctggcacgctgcttcagttgtatgaa
cgtgccatgcaggaccggcgcttggatgctgtgcggaaaaaaatgcaagacttctcggtg
cgggtggtcttcacggcgcaccctacacagttttacccgaacgcggtacaacgcattttg
catgacctgaggtcggctattatgaaagattcggtgacagacatcgacatgctgttgcag
caacttggcaaaacaccgttcctcaaccgcgagaaacctacgcccttggatgaggctctc
agtattattttctatctgcgttacgtgtattacgattctatcggtgagctttaccgtaaa
ataaaaaacacctttggcaaagaccacgaccagcctaatcccaatatttttcagttaggg
ttctggccaggtggcgaccgcgacggtaacccatttgtcaccgcggatattacacgcaag
gtggcgcagcaactgcatatttcgatacttaaatcttattacgcacatctgaaaaagtta
cgccggagacttagtttccgtggcgtctctgatgaactggacatgcttagtgaagaaatt
tacagcgctgtgtatgacggcagaaacatcagtgaaaagcaaattctcagtcgcatcaat
aatgccgaagaaatcttgatgacacaacataacggattgttcagtaatctgcttgatgac
tttaaggatagggtgacgatattcgggacgcattttgctacactcgatatccgccaggac
agccgtgtgcatcagcaagtcattgatgaaattgtgtggcgaaaagcaggctttacgcat
gagcttacctcggaagaaaaacttcattggttgctgtccacacacgaagtcatccggccg
gaagaatttgatgaagtcaccaaagatacacttgaaaacatcatcaatatcaaaaccatc
cagcagaccaatggtgaacgtgggatgagtcgttatatcatctcaaattctgatgaggta
aaagatgtactgaacgtttttgcgatgttcaggctttgcggatatgcggaagaagacatt
aaaatggatattgttcccctgtttgagaccatgcagggcctagatgccgccgcagatgtg
atgaaatctctatatgaattgcctgtttaccgccgccatcttgaaagacggggcaaccag
caaaccatcatgcttggtttttctgatggaacaaaagatggcggatacctaaaagcaaat
tgggaaatctaccagaccaaagaagaactaaccaaacgctccgaggaaaatggcattaac
gtcatcttttttgacggacgtggtggcccgccggcgcgtggcggcgggaaaacccatgat
ttctatgccgcgcagggcaagaccattgccaaccataagattgaaattaccatccagggg
cagaccatcaccagtgtgttcgggaataaggaccaggcaaagtataatttcgagcagtta
ttgaccgcaggtattgaaagcgaagtattcaaaaatgataaaaaagacattgagccttcc
gaaagagcgttgattgccgaacttgcggaactgagtttccgtaaatataccgacctgaaa
tcgcatccccgtttcgtgccttatttgcaggaaatgagtacgttgcaatactacggtaaa
acaaatatcggcagccgccctaccaaacgcggcgcagacggcgatttgaagttcgaagat
ttgcgcgccatcccctttgtaggttcatggagccaactgaaacagaacgttccgggtttc
ttcggatttggtttcgcgctgaatgagcttaaaaaacaggacaggtttgatgagataaag
gccttataccgcggttcggacttctttaaaactttggtactgaactcgatgatgagtatg
aataaaacctatttcccattgacttcttacatgaaggataatgaaacatacggcgaattc
tggcagatattatttgatgaatatcaactttcaaaatccatgatgttagaacttacaggt
tttaaaatgttgatggaagaggaaccattgtcgcgcaagtctataaaaatcagggagaaa
atcgtactgccgctcctcagtatccaacagtatgcgttaatgaaactacataaaaacgaa
ggaaaccgcgaggcctatgaaaaactggtcatgcggtcgcttttcgggaatatcaatgcc
agcaggaattcggcttag

DBGET integrated database retrieval system