KEGG   Chryseobacterium sp. 6424: CO230_06485Help
Entry
CO230_06485       CDS       T05704                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
chrz  Chryseobacterium sp. 6424
Pathway
chrz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:chrz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CO230_06485 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chrz03400]
    CO230_06485 (ligD)
Enzymes [BR:chrz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CO230_06485 (ligD)
DNA repair and recombination proteins [BR:chrz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CO230_06485 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AYO57801
UniProt: A0A3G2TCP9
LinkDB All DBs
Position
1382563..1384419
Genome map
AA seq 618 aa AA seqDB search
MLCGSKDKPFSSPDWIFEIKWDGYRAIADLRKEIQFYSRNGISYLEKFRKIANSLRLQQN
EMILDGELVAYDDEGKPNFQWLQQIGDKPNLNVIFQVFDLLWLNGHSTEELTLLQRKELL
KEALVETEFIKYHDHVLENGEKFFQLIEKMGLEGMIAKKTDSVYQRGARTGDWLKIKKQH
TADVLICGFTAPKGTRKKFGSLILGRYDDGELVFCGHTGTGFTDKVLTELHAKMTPLIIP
ESPFAATPKTNDKPTWLKPKLIAEIKYTEITSDHIFRHPVFLHLREDLEPSDIDFVKDFK
PEAPPAPQKKTVMEKDNETLTKFGKQEVKLTNQNKVYFPKDQVTKGDVVAYYQSVAEYIL
PYLKDRPQSMNRFPNGIEGMSFYQKDASEETPDWIDTQQVYSESNDKYINYILCNDRATM
AYLNNLGCIELNVWTSRVQTIENPDYLVLDLDPSENNTFDDVIETALAVKKIADKAEIKA
FCKTSGSSGIHIYFPTGTAYTFDQVKDFAHLMMQMVQQELPEITTLERALQKRDKNKIYL
DYLQNRRGQTLASVYSLRPKKGAPVSMPLEWDEVRTGLKPTDFNIENALERIKTKGDLFK
PVLGKGFDMLKAIEALGK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcggcagcaaagacaaacctttcagttcacccgactggatttttgaaataaaa
tgggatggttaccgcgccatcgcagaccttcggaaagagatacaattctattcccgtaat
ggtatttcgtatcttgaaaaattcaggaaaatagccaattcgcttcggttacagcaaaac
gaaatgattcttgatggggaattggtagcgtatgatgacgagggtaaacccaatttccag
tggttacagcagataggagataaaccgaatctgaatgttatcttccaggtgtttgatttg
ctttggcttaatggacactcgaccgaagaactgacgcttttacaacgaaaagaactatta
aaggaagccctggtagaaaccgagtttataaaatatcatgaccacgttctcgaaaatggc
gaaaaattctttcaactcatagaaaaaatgggcttagaaggcatgatcgccaaaaaaaca
gattccgtatatcagcgtggcgcccgaaccggcgactggctcaaaatcaagaaacaacat
acggcggatgtgctgatttgtgggtttaccgcgcctaaaggaaccaggaaaaaatttggc
tcactgatcctggggcgatacgatgatggcgaattggtattttgcggacataccggtacg
ggtttcaccgataaagtccttacagaactgcatgcgaaaatgactccgctcatcattcct
gaatcaccttttgccgcaactccgaaaaccaatgataagcctacatggctgaaacccaaa
cttatcgcggagataaaatatacagagatcacttccgatcacatcttcaggcaccctgta
tttctacatcttcgggaagatttagagcccagcgatattgattttgtcaaagattttaaa
cctgaagcaccaccggcacctcaaaaaaaaaccgtcatggaaaaagataatgaaacactt
accaaattcggtaagcaggaggtaaaactcaccaatcagaacaaagtttattttccgaaa
gatcaggtaacaaaaggcgatgtggtagcatactatcaaagcgtggccgaatatatcctg
ccttacctgaaagaccgtccacaatccatgaaccgctttcccaacggcatagaaggcatg
agtttctatcagaaagacgcttccgaggaaacaccggattggatcgatacgcagcaggta
tattccgaatctaatgataaatacatcaattacatcctttgtaatgaccgcgctacgatg
gcctatctgaacaatctcggctgtattgaactgaatgtctggacaagccgtgtgcaaact
atagagaatccggattatcttgtccttgaccttgatccctccgaaaacaatacttttgat
gacgtcatcgaaacagcgcttgccgtaaagaaaatcgctgacaaggcagaaattaaggca
ttctgcaaaacctctggcagttcaggcatccatatttattttcctaccggtactgcttat
acgtttgaccaggtgaaagatttcgcccatttaatgatgcagatggtacaacaggaactc
cccgagatcaccacattggaacgtgctttacagaaacgcgacaaaaacaagatatatctc
gattatctgcaaaaccggcgtggccaaaccttagcgagtgtctatagtttgcgcccaaag
aaaggcgcaccagtctccatgccgctggaatgggatgaagtaaggaccggtttgaaacct
accgatttcaatattgaaaatgccctggagcgtatcaaaaccaaaggtgatctgtttaaa
cctgtacttggtaaagggtttgatatgttaaaagccatcgaagccctcgggaaatag

DBGET integrated database retrieval system