KEGG   Chlamydia psittaci 01DC11: CPS0A_0507Help
Entry
CPS0A_0507        CDS       T01860                                 

Definition
(GenBank) GTP-dependent nucleic acid-binding protein
  KO
K06942  ribosome-binding ATPase
Organism
chs  Chlamydia psittaci 01DC11
Brite
KEGG Orthology (KO) [BR:chs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:chs03009]
    CPS0A_0507
Ribosome biogenesis [BR:chs03009]
 Prokaryotic type
  Other maturation factors
   CPS0A_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS OMPdecase
Motif
Other DBs
NCBI-ProteinID: AEG86487
UniProt: A0A0E2JCA6
LinkDB All DBs
Position
520765..521859
Genome map
AA seq 364 aa AA seqDB search
MGHTECGIVGLPNVGKSGLFNALTGAQVASCNYPFCTIDPNIGIVPVIDDRLDILAKMSQ
SQKVIYADMKFVDIAGLVKGAADGAGLGNRFLSHIRETHAVAHVVRCFDNDDITHVSGKI
DPSDDISVINLELIFSDFSSATSIYSKLEKQAKGKNDLGIVLPLLDRVIKHLESGQPVRT
LNLSSEEQIQLKPYPFLTAKPMLYIANIGEDSIATMHNDYVAVVEEIARKENAPVVPICV
QLEEEIISLPVEERKDFLNSLGLKESGLNRLVRAAYHTLGLISYFTTGPQETRAWTIPIG
STAAEAAGQIHTDIQKGFIRAEVVTLEDMITYGSRTGVREAGKLRAEGRDYIVQDGDIML
FLHN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggcatacagaatgtggcatcgtaggacttcccaatgtaggtaagtctgggttattt
aatgctcttactggagcgcaagtagcttcttgtaactatcccttttgcacaattgatccg
aatattggtattgttccggttattgatgaccgcttagatattttagctaagatgagtcag
agtcaaaaggttatctatgccgatatgaagtttgtggatattgctggtttggtgaaggga
gctgcagatggagcaggattaggaaataggtttctttctcatattcgcgagacgcatgct
gtggctcatgttgttcgttgttttgacaatgacgatattactcatgtatcgggaaagata
gatcccagtgatgacatttccgtgataaatttagaattgatcttttctgatttttcttct
gcaacaagtatttatagcaaattagagaagcaagctaaggggaagaacgacctagggatt
gttttacctttacttgatagagtgattaaacatttagaaagtggtcaacctgttcgcacg
ttaaatttatcttcagaagagcagatacaactcaaaccttatccctttttaacagcaaag
cctatgttgtatatagcgaacataggtgaggattcaatagcaacgatgcacaatgattat
gttgctgttgttgaagaaattgccagaaaggaaaatgctcctgttgttcctatttgtgta
caattagaagaagaaatcatttcgcttcctgtagaggaacggaaagactttttaaatagt
ttagggctaaaagaatcgggattaaatcgcttagttcgtgctgcttatcatacactggga
ttgatttcttattttacaactggaccacaagaaaccagggcttggactattcctatagga
tctacagctgcggaagctgcaggccagattcacaccgatattcaaaaagggtttatccga
gccgaagttgtgactcttgaagatatgatcacctatggaagccgtacaggagtccgcgaa
gctggcaaattacgagcagagggtagagactacattgtgcaggacggcgatattatgctt
ttcttgcataattag

DBGET integrated database retrieval system