KEGG   Chlamydia psittaci 08DC60: CPS0D_0381Help
Entry
CPS0D_0381        CDS       T01862                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cht  Chlamydia psittaci 08DC60
Brite
Enzymes [BR:cht01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPS0D_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: AEG88322
LinkDB All DBs
Position
396629..397246
Genome map
AA seq 205 aa AA seqDB search
MTFVPYTLPPLPYDYSALEPVISAEIMHLHHQKHHQGYINNLNEALKKLDLADTQQDLTR
LIALEPTLRFNGGGHINHSLFWEMLAPIGQGGGVPPKHGLLKLIEKFWGTFDNFLKEFIK
FAAPIQGSGWAWLAFCPEKQELMLHATANQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPQVINWGYIEKRFSEITN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgttccctatactttgcccccattgccctatgattattctgctctagagcca
gtaattagtgctgagattatgcatctacatcatcaaaagcatcatcaaggttatataaat
aatttgaatgaggccttgaagaagttagatctggctgatacacaacaagaccttacgcga
ttgattgctttggagcctactctacgatttaatggtgggggacatattaaccactcccta
ttttgggaaatgctcgccccgataggtcaaggcggaggggtccctccaaagcacggctta
ctgaagctgattgagaaattctggggaacttttgacaactttttaaaagaatttattaaa
tttgccgctccgattcaggggtctgggtgggcttggctagctttttgtcccgaaaaacag
gagcttatgctacacgcaacagcaaaccaggatcctctagaagccaccaccggtaaggtg
cctcttctcggagtagatgtctgggagcatgcgtattacctccagtataaaaatgttaga
ttagattatttaaaagcaattcctcaagtaattaattggggatatattgaaaaaagattt
tctgagataactaattaa

DBGET integrated database retrieval system