KEGG   Campylobacter helveticus: CHELV3228_0164Help
Entry
CHELV3228_0164    CDS       T04807                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acp] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
chv  Campylobacter helveticus
Pathway
chv00061  Fatty acid biosynthesis
chv00780  Biotin metabolism
chv01100  Metabolic pathways
chv01130  Biosynthesis of antibiotics
chv01212  Fatty acid metabolism
Module
chv_M00083  Fatty acid biosynthesis, elongation
chv_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:chv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CHELV3228_0164 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CHELV3228_0164 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CHELV3228_0164 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:chv01004]
    CHELV3228_0164 (fabI)
Enzymes [BR:chv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CHELV3228_0164 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CHELV3228_0164 (fabI)
Lipid biosynthesis proteins [BR:chv01004]
 Fatty acid synthase
  Component type
   CHELV3228_0164 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ARE79830
UniProt: A0A1V0RDL2
LinkDB All DBs
Position
150400..151227
Genome map
AA seq 275 aa AA seqDB search
MIMQGKKGLIVGVANNKSIAYGIAKACAAQGANLAFTFLNEALKKRVEPIAAEFNSSAVY
ELDVNNEAHLENIASLIKRDLGEIDFVVHAVAFAPKEALENSFLQTSKEAFDIAMQTSVY
SLLSLTRAVLPVLKDNGSILTLSYLGGVKYVPHYNVMGVAKAALESSVRYLARDLGGRGI
RVNAISAGPIKTLAASGIGDFRMILKYNEINAPLKRNVSIEDVGNSAMYLLSDLSSGVTG
EIHYVDAGYNIMGMGDVTQDEEGRTILCWDKSNGQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgataatgcaaggtaaaaaaggcttaatagtcggcgtagcaaataataaatccatcgct
tatggtatcgctaaagcttgtgcggcacagggggcaaatttagcttttacttttttaaat
gaggctttaaaaaagcgtgttgagcctatcgcggcggaatttaactcaagtgctgtttat
gagcttgatgtcaataatgaagcacatttggaaaatatcgcctctttgattaagagggac
ttaggtgagattgattttgtcgttcatgctgtggcttttgctcctaaggaagctttggaa
aattcatttttgcaaacgagtaaagaggcttttgacatcgctatgcaaacctcagtatat
tctttactttctcttacaagggcggttttacctgtattaaaagataatggctcgattttg
actttgagctatttaggtggcgtgaagtatgtgccgcattataatgttatgggcgtggct
aaggcggctttggaaagttcagtgaggtatctagcaagagatttgggagggcgaggaatt
cgcgttaatgccatttcagcaggtcctataaaaactttagcggcaagtgggataggcgat
tttagaatgattttaaaatataatgaaatcaacgctccattaaaacgcaatgttagcata
gaagatgtgggaaattctgcgatgtatttacttagtgatttatcaagtggagttacggga
gaaattcattatgttgatgcaggatacaatataatgggtatgggcgatgtaacgcaagat
gaagagggtagaaccatactttgctgggataagagtaatggacaatga

DBGET integrated database retrieval system