KEGG   Campylobacter hepaticus: A2J15_001010Help
Entry
A2J15_001010      CDS       T05589                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
chw  Campylobacter hepaticus
Pathway
chw00970  Aminoacyl-tRNA biosynthesis
chw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A2J15_001010 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chw03029]
    A2J15_001010 (gatB)
Enzymes [BR:chw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A2J15_001010 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A2J15_001010 (gatB)
Mitochondrial biogenesis [BR:chw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A2J15_001010 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey PX
Motif
Other DBs
NCBI-ProteinID: AXP08330
LinkDB All DBs
Position
204897..206315
Genome map
AA seq 472 aa AA seqDB search
MFEVVIGLEVHAQLNTKTKIFCSCATSFGEDPNINVCPTCLALPGALPVLNEEAVKKAIA
FGKAINATINKKSIFNRKNYFYPDLPKAYQISQFDIPIVENGELVININGEQKRIGITRA
HLEEDAGKSIHESGFSKVDLNRAGTPLLEIVSEPELRSSDEAVAYLKKLHAIIRFLNISD
ANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEIKRQSEAWEDGIYK
EKVVQETRLFDTTYLITKSMRDKEEATEYRYFPDPDLLPVLLKDEFLNIKIPELPDEKKI
RFVNELGIKESDAEVLISSLEMSRFFEDLISQNLNPKLCVNWLNTELMGLLKGDFTIENS
PIDAKKLGSLIKRIEEGIISAKAAKDVLAYVFENTNIDIDLAIDQLGLKQVSDDLAIEKV
VEQILNANPSKVIEYKNGKDKLFGFFVGQIMKESKGAFNPTKVNTILKAKLD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtcgttataggacttgaagttcatgctcaacttaatactaaaacaaaaatt
ttttgttcatgtgcaacttcttttggagaagatccaaatattaatgtttgtcctacttgt
ttagctttgccaggtgctttacctgttttaaatgaagaagctgtaaaaaaagctatagct
tttggaaaagctataaacgcaactattaacaaaaaaagtatttttaatcgtaaaaattat
ttttatcctgatctacctaaagcttatcaaatttcacaatttgatattcctatagtagaa
aatggagagcttgttattaatataaatggagagcaaaaacgtatagggattacaagggcg
catttagaagaagatgcgggtaaaagtattcatgaaagtgggttttctaaagttgattta
aatcgtgcaggaacgcctttgcttgaaatagttagtgaaccagagcttagaagcagtgat
gaagctgtagcttatcttaaaaaattacatgctattatacgttttttaaatatttctgat
gcaaatatgcaagaaggaagttttaggtgtgatgcaaatgtcagtataagaccaaaaggt
gatactaaactttatactagggtggaaattaaaaatcttaattcttttcgttttattcaa
aaagctatagaatatgaaataaaaagacaaagtgaggcttgggaagatgggatttataaa
gaaaaagtagtgcaagaaactagactttttgataccacttatttgattacaaaaagcatg
cgtgataaggaagaggctacagaatatcgttattttcctgatcctgatttgttgccagtt
ttattaaaagatgaatttttaaatataaaaattcctgaattgcctgatgagaaaaaaata
cgttttgtaaatgaattagggataaaagaaagcgatgctgaagtattgattagttcgctt
gagatgagtcgtttttttgaagatttaatttctcaaaatttaaatcctaagctttgtgtg
aattggttaaatactgagcttatgggtttattaaaaggtgatttcactatagaaaattct
cctattgatgcaaaaaagcttggtagtttaatcaaacgtatagaagagggtattataagt
gcaaaagctgctaaagatgtcttagcttatgtatttgaaaatacaaatattgatattgat
ttagctatagatcaattaggacttaaacaagttagtgatgatttggctatagaaaaagtg
gttgaacaaattctaaatgcaaatccaagcaaagttatagaatacaaaaatggtaaagat
aagctttttggtttttttgtaggtcagattatgaaagaaagtaaaggtgcttttaatcct
actaaagttaatactattttaaaagcaaagcttgattga

DBGET integrated database retrieval system