KEGG   Capra hircus (goat): 100846984
Entry
100846984         CDS       T02910                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04071  Sphingolipid signaling pathway
chx04115  p53 signaling pathway
chx04141  Protein processing in endoplasmic reticulum
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04722  Neurotrophin signaling pathway
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100846984 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100846984 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100846984 (BAX)
   04215 Apoptosis - multiple species
    100846984 (BAX)
   04217 Necroptosis
    100846984 (BAX)
   04115 p53 signaling pathway
    100846984 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100846984 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100846984 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100846984 (BAX)
   05202 Transcriptional misregulation in cancer
    100846984 (BAX)
   05203 Viral carcinogenesis
    100846984 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100846984 (BAX)
   05212 Pancreatic cancer
    100846984 (BAX)
   05225 Hepatocellular carcinoma
    100846984 (BAX)
   05226 Gastric cancer
    100846984 (BAX)
   05214 Glioma
    100846984 (BAX)
   05216 Thyroid cancer
    100846984 (BAX)
   05220 Chronic myeloid leukemia
    100846984 (BAX)
   05217 Basal cell carcinoma
    100846984 (BAX)
   05218 Melanoma
    100846984 (BAX)
   05213 Endometrial cancer
    100846984 (BAX)
   05224 Breast cancer
    100846984 (BAX)
   05222 Small cell lung cancer
    100846984 (BAX)
   05223 Non-small cell lung cancer
    100846984 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100846984 (BAX)
   05014 Amyotrophic lateral sclerosis
    100846984 (BAX)
   05016 Huntington disease
    100846984 (BAX)
   05020 Prion disease
    100846984 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100846984 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100846984 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100846984 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100846984 (BAX)
   05152 Tuberculosis
    100846984 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100846984 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100846984 (BAX)
   05161 Hepatitis B
    100846984 (BAX)
   05160 Hepatitis C
    100846984 (BAX)
   05164 Influenza A
    100846984 (BAX)
   05162 Measles
    100846984 (BAX)
   05168 Herpes simplex virus 1 infection
    100846984 (BAX)
   05163 Human cytomegalovirus infection
    100846984 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100846984 (BAX)
   05169 Epstein-Barr virus infection
    100846984 (BAX)
   05165 Human papillomavirus infection
    100846984 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100846984 (BAX)
   01524 Platinum drug resistance
    100846984 (BAX)
   01522 Endocrine resistance
    100846984 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chx03029]
    100846984 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chx02000]
    100846984 (BAX)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100846984 (BAX)
Transporters [BR:chx02000]
 Other transporters
  Pores ion channels [TC:1]
   100846984 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 100846984
NCBI-ProteinID: XP_013826900
LinkDB
Position
18
AA seq 260 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGCPLAESLKCLLSLSPGRPPLL
LWDTHMADGDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGEVDLGAMGVFLT
FVIIGVGQGREEWSWGGWAQ
NT seq 783 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctgagc
gagtgtctgaagcgcattggagatgaattggacagtaacatggagctgcagaggatgatc
gcagccgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatgttt
tccgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgcccgagttgatcaggaccatcatgggctggaca
ttggacttccttcgagagcggctgctgggctggatccaggaccagggtggttggggctgc
cccttggctgagtcgctgaagtgcctgctgtccctgtccccaggacggcctcctctccta
ctttgggacacccacatggcagacggtgaccatctttgtggctggagtgctcaccgcctc
gctcaccatctggaagaagatgggctgaggccatcaactgccttggactttttctgcata
aattatggcatttttcaagggggggaggtggatttgggggccatgggagtttttcttact
tttgtaattattggggtggggcagggtagggaggagtggtcttggggggggtgggcgcaa
taa

DBGET integrated database retrieval system