KEGG   Capra hircus (goat): 100860742
Entry
100860742         CDS       T02910                                 

Gene name
NOS2, iNOS
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
chx  Capra hircus (goat)
Pathway
chx00220  Arginine biosynthesis
chx00330  Arginine and proline metabolism
chx01100  Metabolic pathways
chx04020  Calcium signaling pathway
chx04066  HIF-1 signaling pathway
chx04146  Peroxisome
chx04371  Apelin signaling pathway
chx04926  Relaxin signaling pathway
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
chx05133  Pertussis
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05200  Pathways in cancer
chx05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100860742 (NOS2)
   00330 Arginine and proline metabolism
    100860742 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100860742 (NOS2)
   04066 HIF-1 signaling pathway
    100860742 (NOS2)
   04020 Calcium signaling pathway
    100860742 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100860742 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100860742 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860742 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100860742 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100860742 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100860742 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100860742 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100860742 (NOS2)
   05152 Tuberculosis
    100860742 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100860742 (NOS2)
   05145 Toxoplasmosis
    100860742 (NOS2)
   05140 Leishmaniasis
    100860742 (NOS2)
   05142 Chagas disease
    100860742 (NOS2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100860742 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100860742
NCBI-ProteinID: XP_013827406
UniProt: A0A452FQT1
LinkDB
Position
19
AA seq 1154 aa
MACPWQFLFKIKSQKVDLTTELDINNNVRKGHQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPDPLGKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPASVEFTQLCIDLGWKPKFS
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFQELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYILSPFYYYQVEAWKTHVWQDERRRPQRREIRFKVLIKAVFFASVLMQKAMSSRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYQLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACEIFDVSGKHHIEIPKLYTSSVTWDPHHYRLVQDSEPLDL
NKALSSMHAKPVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQ
PALVQGILERVVDGPAPHQPVRLETLCENGSYWVKDKRLPPCSLSQALTHFLDITTPPTQ
LLLRKLAQLATEEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLRPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVAHSLKQLMATALSLDEEQVEDYFFQLKSQKRYHEDIFGAVFPYEMKKDG
AAPSDPRAPGANRS
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaaatcaaatcccaaaaggtggacttgactacg
gaactggacatcaacaacaacgtcagaaaaggccaccagcccccgtccagtccagtgaca
caggatgaccccaaacgtcacagcccgggcaagcacgggaatgagtctccccagcccctc
acggggacggtaaagacatctccagatcccctgggcaagctggacgcacccccgtcagcc
tgtccacggcatgtgaggatcaaaaactggggcagtggagtgactttccaagacacgctt
caccagaaggccaaaggggatctctcttgcaagtccaagtcttgcctggcatccatcatg
aaccccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatctttgccaccaagcaggcctggcgcaacgccccccgctgc
atcgggaggatccagtggtcgaacctgcaggtctttgacgcccggagctgttccacggcc
caggaaatgttcgaacacatctgcagacacgtgcgttacgccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccgggtctgg
aatgcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggac
cccgccagcgtggagttcacacagctgtgcatcgacctgggctggaagcccaagttcagc
cgcttcgacgtgttgcctctagtcctgcaggctgatggccgcgacccagagctcttcgaa
atcccccctgaccttgtgcttgaggtgcccatggaacatcccaggtacgaatggttccag
gagctggagctcaagtggtacgctctgccagccgtggccaacatgctgcttgaggtgggc
ggccttgagttcccagggtgccccttcaacgggtggtacatgggcacggaggttggagtc
cgggacttctgcgacgtccagcgatacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcgctctggaaggaccgggctgtcgttgagatcaacgtc
gctgtgctccacagcttccagaagcagaatgtgaccatcatggaccaccactccgctgca
gagtccttcatgaagtacatgcagaatgagtaccgctcccgagggggctgcccagctgac
tggatttggctggtccccccgatttctggaagcatcacccccgtgttccaccaggaaatg
ctaaattacatcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggacgagaggcggaggccccagagaagagagattcgattcaaggtcttgatcaaa
gccgtgttcttcgcctcggtgctgatgcagaaggccatgtcatcccgggtcagagccacg
atcctctttgcaacagagacagggagatcggaaacgctggcccaagaccttggggctttg
ttcagctgtgccttcaaccccaaggttctctgcatggatcagtaccagctgagccatctg
gaggaggaacagctgctgctggtggtgaccagcacttttggcaacggagactcccctggc
aacggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacaagttccgg
tacgccgtgtttggccttggctccagcatgtaccctcagttctgcgcttttgctcacgac
atcgaccagaagttgtcccagctgggggcttctcagcttgccccaaccggggaaggggat
gaactcagcgggcaggaggaggccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagatattcgatgtcagtggcaagcaccacattgagatccccaagctctacacttcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcagagcctctggacctc
aacaaagccctgagcagtatgcacgccaagcctgtgttcaccatgaggctcaaatcgcag
cagaatctgcagagtccgaaatccagccgcaccaccctcctggtggaactctcctgtgag
ggcagccaagctccaagctacctgccgggagagcacctcggagttttcccatgcaaccag
ccagccctggttcaaggcatccttgagcgagtggtggatggccctgccccgcaccagccc
gtgcgcctggagaccctctgtgagaatggcagctactgggtcaaggacaagcgactgcca
ccttgctcactcagccaggctctcacccatttcctggacatcaccaccccgccaacccag
ctgctgcttcgaaagctggcccagctggccacagaagaggctgagaggcagaggctggag
accctatgccagccctcagattacaacaagtggaagttcaccaacagccccacattcctg
gaggtgctggaggaattcccgtccctgcgggtatctgccagcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggacctcagacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcac
catggtgtctgcagcacgtggctcagcagcttgaagccccaggacccagtgccctgcttt
gtgcgaagtgccagcggcttccagcttcctgaggaccgctcccgtccttgcatcctcatc
gggcccggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgaggct
gagcacaaagggctccagggcggccgcatgaccctggttttcgggtgccgccgcccggaa
gaggaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcacgag
gtgcacacagcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctg
cggcagcggctggcaggcgaggtgcttcgtgtgctccatgaagagcaaggccacctctat
gtctgcggggacgtgcgcatggcccgggacgtggcccacagcctgaagcagctgatggct
actgcgctgagcctggacgaggaacaggtggaggactatttcttccagctcaagagccag
aagcgctatcatgaagacatctttggtgctgtatttccctatgagatgaaaaaggatggg
gcagcgcccagcgatcccagggctccaggcgccaacagaagttaa

DBGET integrated database retrieval system