KEGG   Capra hircus (goat): 100860751
Entry
100860751         CDS       T02910                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
chx  Capra hircus (goat)
Pathway
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04114  Oocyte meiosis
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04914  Progesterone-mediated oocyte maturation
chx04934  Cushing syndrome
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05215  Prostate cancer
chx05222  Small cell lung cancer
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100860751 (CDK2)
   04151 PI3K-Akt signaling pathway
    100860751 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100860751 (CDK2)
   04114 Oocyte meiosis
    100860751 (CDK2)
   04115 p53 signaling pathway
    100860751 (CDK2)
   04218 Cellular senescence
    100860751 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100860751 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860751 (CDK2)
   05203 Viral carcinogenesis
    100860751 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100860751 (CDK2)
   05215 Prostate cancer
    100860751 (CDK2)
   05222 Small cell lung cancer
    100860751 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100860751 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100860751 (CDK2)
   05161 Hepatitis B
    100860751 (CDK2)
   05160 Hepatitis C
    100860751 (CDK2)
   05162 Measles
    100860751 (CDK2)
   05169 Epstein-Barr virus infection
    100860751 (CDK2)
   05165 Human papillomavirus infection
    100860751 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100860751 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:chx03032]
    100860751 (CDK2)
   03036 Chromosome and associated proteins [BR:chx03036]
    100860751 (CDK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100860751 (CDK2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100860751 (CDK2)
DNA replication proteins [BR:chx03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100860751 (CDK2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100860751 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100860751
NCBI-ProteinID: NP_001272537
UniProt: A0MSV8
LinkDB
Position
5
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaagttgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgccatacgagagatctctctgcttaaggagcttaatcac
cctaatattgtcaagctgctggatgtcattcacacagaaaacaagctctaccttgttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgcactcactggcattcct
cttccgctcataaagagctacttgttccagctgctccagggcctagctttctgccactct
catcgggtcctgcaccgagaccttaaacctcagaatctgcttatcaacgcagatgggtcc
atcaagctagcagacttcggactagccagagcttttggggtccctgttcgtacttatacc
cacgaggtggtgactctgtggtaccgagcaccggaaatccttctgggctgcaaatactac
tccacagcagtggacatatggagcctcggttgcatctttgctgagatggtgacccgccgg
gccctattccccggagattctgagatcgaccaactcttccggatctttcggaccctggga
accccagatgaggtggtttggccaggagttacttctatgcctgattataagccaagtttc
cccaagtgggccaggcaggattttagcaaagtggtgcctcccctggatgaagatggacgg
agcttgttatcgcaaatgctgcactacgaccctaacaagcggatttcagccaaggcagct
ttggctcaccccttcttccaagatgtgaccaagccagtacctcaccttcgactctga

DBGET integrated database retrieval system