KEGG   Capra hircus (goat): 100860813
Entry
100860813         CDS       T02910                                 

Gene name
Cahi-DQA2
Definition
(RefSeq) HA25
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100860813 (Cahi-DQA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100860813 (Cahi-DQA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100860813 (Cahi-DQA2)
   04612 Antigen processing and presentation
    100860813 (Cahi-DQA2)
   04658 Th1 and Th2 cell differentiation
    100860813 (Cahi-DQA2)
   04659 Th17 cell differentiation
    100860813 (Cahi-DQA2)
   04672 Intestinal immune network for IgA production
    100860813 (Cahi-DQA2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100860813 (Cahi-DQA2)
   05322 Systemic lupus erythematosus
    100860813 (Cahi-DQA2)
   05323 Rheumatoid arthritis
    100860813 (Cahi-DQA2)
   05320 Autoimmune thyroid disease
    100860813 (Cahi-DQA2)
   05321 Inflammatory bowel disease
    100860813 (Cahi-DQA2)
   05330 Allograft rejection
    100860813 (Cahi-DQA2)
   05332 Graft-versus-host disease
    100860813 (Cahi-DQA2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100860813 (Cahi-DQA2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100860813 (Cahi-DQA2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100860813 (Cahi-DQA2)
   05152 Tuberculosis
    100860813 (Cahi-DQA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100860813 (Cahi-DQA2)
   05164 Influenza A
    100860813 (Cahi-DQA2)
   05168 Herpes simplex virus 1 infection
    100860813 (Cahi-DQA2)
   05169 Epstein-Barr virus infection
    100860813 (Cahi-DQA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100860813 (Cahi-DQA2)
   05140 Leishmaniasis
    100860813 (Cahi-DQA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    100860813 (Cahi-DQA2)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100860813 (Cahi-DQA2)
  Exosomal proteins of epithelial cells
   100860813 (Cahi-DQA2)
  Exosomal proteins of breast milk
   100860813 (Cahi-DQA2)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 I-set SKG6
Other DBs
NCBI-GeneID: 100860813
NCBI-ProteinID: NP_001272609
UniProt: B2CZF2
LinkDB
Position
23
AA seq 255 aa
MVLNRALILGALALTTMMSPSGGEDIVADHVGSYGTEIYQSHGPSGQYTQEFDGDEMFYV
DLGKKETVWRLPMFSQFAGFDPQGALSEIATAKQNLDILTKHSNFTPAINEVPEVTVFSK
SPVMLSQPNTLICHVDNIFPPVINITWLKNGHAVTEGVSETSFLPKDDHSFLKIGYLTFL
PSDDDVYDCKVEHWGLDEPLLKHWEPETPAPMSELTETVVCALGLTVGLVGIVVGTIFII
QGLRSGGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggtcctgaacagagctctgattctgggggccctcgccctgaccaccatgatgagcccc
agtggaggtgaagacattgtggctgaccacgttggctcctatggcacagagatctaccaa
tctcatggtccctctggccagtacacccaggaatttgatggagacgagatgttttatgtg
gacctggggaagaaggagactgtctggagactgcctatgtttagccagtttgcaggtttt
gatccacagggtgcactgagtgaaatagctacagcaaaacaaaacttggatatcctgact
aaacactccaactttacccctgctatcaatgaggttcctgaggtgactgtgttttccaag
tctcccgtgatgctgagtcagcccaacaccctcatctgtcacgtggacaacattttcccc
cctgtgatcaacatcacatggctgaagaacgggcatgcagtcacagagggtgtttctgag
accagcttccttcccaaggatgatcattccttcctcaagattggttatctcaccttcctc
ccttctgatgatgacgtttatgactgcaaagtggagcactggggcctggatgagccactt
ctgaaacactgggagcctgagactccagcccctatgtcagagctgacggagactgtggtc
tgtgccctggggttgaccgtgggccttgtgggcatcgtggtgggcaccatcttcatcatc
caaggcctgcgctcaggtggggcctccagacaccagggtcccttgtga

KEGG   Capra hircus (goat): 102173458
Entry
102173458         CDS       T02910                                 

Gene name
DRB*A
Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102173458 (DRB*A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102173458 (DRB*A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102173458 (DRB*A)
   04612 Antigen processing and presentation
    102173458 (DRB*A)
   04658 Th1 and Th2 cell differentiation
    102173458 (DRB*A)
   04659 Th17 cell differentiation
    102173458 (DRB*A)
   04672 Intestinal immune network for IgA production
    102173458 (DRB*A)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102173458 (DRB*A)
   05322 Systemic lupus erythematosus
    102173458 (DRB*A)
   05323 Rheumatoid arthritis
    102173458 (DRB*A)
   05320 Autoimmune thyroid disease
    102173458 (DRB*A)
   05321 Inflammatory bowel disease
    102173458 (DRB*A)
   05330 Allograft rejection
    102173458 (DRB*A)
   05332 Graft-versus-host disease
    102173458 (DRB*A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102173458 (DRB*A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102173458 (DRB*A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102173458 (DRB*A)
   05152 Tuberculosis
    102173458 (DRB*A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102173458 (DRB*A)
   05164 Influenza A
    102173458 (DRB*A)
   05168 Herpes simplex virus 1 infection
    102173458 (DRB*A)
   05169 Epstein-Barr virus infection
    102173458 (DRB*A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102173458 (DRB*A)
   05140 Leishmaniasis
    102173458 (DRB*A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102173458 (DRB*A)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102173458 (DRB*A)
  Exosomal proteins of epithelial cells
   102173458 (DRB*A)
  Exosomal proteins of breast milk
   102173458 (DRB*A)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 vMSA DUF202 ig
Other DBs
NCBI-GeneID: 102173458
NCBI-ProteinID: NP_001301095
UniProt: O19200
LinkDB
AA seq 266 aa
MVCLYFSGGSRMAALIVMLMMLSPPLAWAREIQPHFLEYYKAECHFSNGTGRVRLLHRFY
TNGEETVRFDSDWGEFRAVTEQGQEDAKYWNSQKDFLEQKRAEVDTVCRHNYGVLESFTV
QRRVEPAVTVYPTKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNGHEEEAGVISTGLIQNG
DWTFQTMVMLETVPQGGEVYTCQVEHPSRTSPITVEWRARSDSAQGKMMSGVGGFVLGLL
FLAVGLFIYFRNQKGRPTLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtatttctctgggggctcccggatggcggctctgatagtgatgctgatg
atgctgagccctcccctggcctgggccagggagatccaaccacatttcctggagtattat
aaggccgagtgtcatttctccaacgggaccgggcgggtgcggttgctgcacagattctac
actaatggagaagagaccgtgcgcttcgacagcgactggggcgagttccgggcggtgacc
gagcaggggcaggaggacgccaagtactggaacagccagaaggacttcctggagcagaag
cgggccgaggtggacacggtgtgcagacataactacggggtccttgagagtttcactgtg
cagcggcgagtggagcctgcagtgactgtgtatcctacaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggattctacccaggccacattgaagtcaggtgg
ttccggaacggccacgaagaggaggctggggtgatctccacaggcctgatccagaatgga
gactggaccttccagaccatggtgatgcttgaaacagttcctcagggtggagaggtctac
acctgccaagtggagcaccccagccggacgagccctatcacagtagagtggagggcacgg
tctgactcagctcagggcaagatgatgagtggagttgggggcttcgtgctgggcctgctc
ttccttgcggtggggctcttcatctacttcaggaatcagaaaggacgccctacacttcag
ccaacagggctcctgagctga

KEGG   Capra hircus (goat): 102179660
Entry
102179660         CDS       T02910                                 

Gene name
Cahi-DRB1, DRB*B, DRB3
Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-4 beta chain-like
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102179660 (Cahi-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102179660 (Cahi-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102179660 (Cahi-DRB1)
   04612 Antigen processing and presentation
    102179660 (Cahi-DRB1)
   04658 Th1 and Th2 cell differentiation
    102179660 (Cahi-DRB1)
   04659 Th17 cell differentiation
    102179660 (Cahi-DRB1)
   04672 Intestinal immune network for IgA production
    102179660 (Cahi-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102179660 (Cahi-DRB1)
   05322 Systemic lupus erythematosus
    102179660 (Cahi-DRB1)
   05323 Rheumatoid arthritis
    102179660 (Cahi-DRB1)
   05320 Autoimmune thyroid disease
    102179660 (Cahi-DRB1)
   05321 Inflammatory bowel disease
    102179660 (Cahi-DRB1)
   05330 Allograft rejection
    102179660 (Cahi-DRB1)
   05332 Graft-versus-host disease
    102179660 (Cahi-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102179660 (Cahi-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102179660 (Cahi-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102179660 (Cahi-DRB1)
   05152 Tuberculosis
    102179660 (Cahi-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102179660 (Cahi-DRB1)
   05164 Influenza A
    102179660 (Cahi-DRB1)
   05168 Herpes simplex virus 1 infection
    102179660 (Cahi-DRB1)
   05169 Epstein-Barr virus infection
    102179660 (Cahi-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102179660 (Cahi-DRB1)
   05140 Leishmaniasis
    102179660 (Cahi-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102179660 (Cahi-DRB1)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102179660 (Cahi-DRB1)
  Exosomal proteins of epithelial cells
   102179660 (Cahi-DRB1)
  Exosomal proteins of breast milk
   102179660 (Cahi-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 vMSA DUF202 ig
Other DBs
NCBI-GeneID: 102179660
NCBI-ProteinID: NP_001301146
UniProt: O19201
LinkDB
AA seq 266 aa
MVCLYFSRGSRMAALIVMLMVLSPPLAWARKIQPHFLRYCKRECHFSNGTERVGLLDRYF
HNGEEIVRFDSDWGEFRAVTELGRPDAEYWNSQKEILESRRTAVDTYCRHNYGVVESFTV
QRRVEPTVTVYPAKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNSHEEEAGVISTGLIQNG
DWTFQTMVMLETVPQSGEVYTCQVEHPSRTSPITVEWRARSDSAQSKMMSGVGGFVLGLL
FLAVGLFIYFRNQKGRPTLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtatttctccagaggctcccggatggcagctctgatagtgatgctgatg
gtgctgagccctcccctggcctgggccaggaagatccaaccacatttcctgaggtattgt
aagagagagtgtcatttctccaacgggaccgagcgggtggggcttctggacagatacttc
cataatggagaagagatcgtgcgcttcgacagcgactggggcgagttccgggcagtgacc
gagctggggcggccggatgccgagtactggaacagccagaaggagatcctggagagcagg
aggaccgcggtggacacgtactgcagacacaactacggggtcgttgagagtttcactgtg
cagcggcgagtggagcctacagtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggattctacccaggccacattgaagtcaggtgg
ttccggaacagccatgaagaggaggctggagtgatctccacaggcctgatccagaatgga
gactggaccttccagaccatggtgatgcttgaaacagttcctcagagtggagaggtctac
acctgccaagtggagcaccccagccggacgagccctatcacagtagaatggagggcacgg
tctgactcagctcagagcaagatgatgagtggagtcgggggcttcgtgctgggtctgctc
ttccttgcggtggggctcttcatctacttcaggaatcagaaaggacgccctacccttcag
ccaacagggctcctgagctga

KEGG   Capra hircus (goat): 102179937
Entry
102179937         CDS       T02910                                 

Gene name
Cahi-DQA1
Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102179937 (Cahi-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102179937 (Cahi-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102179937 (Cahi-DQA1)
   04612 Antigen processing and presentation
    102179937 (Cahi-DQA1)
   04658 Th1 and Th2 cell differentiation
    102179937 (Cahi-DQA1)
   04659 Th17 cell differentiation
    102179937 (Cahi-DQA1)
   04672 Intestinal immune network for IgA production
    102179937 (Cahi-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102179937 (Cahi-DQA1)
   05322 Systemic lupus erythematosus
    102179937 (Cahi-DQA1)
   05323 Rheumatoid arthritis
    102179937 (Cahi-DQA1)
   05320 Autoimmune thyroid disease
    102179937 (Cahi-DQA1)
   05321 Inflammatory bowel disease
    102179937 (Cahi-DQA1)
   05330 Allograft rejection
    102179937 (Cahi-DQA1)
   05332 Graft-versus-host disease
    102179937 (Cahi-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102179937 (Cahi-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102179937 (Cahi-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102179937 (Cahi-DQA1)
   05152 Tuberculosis
    102179937 (Cahi-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102179937 (Cahi-DQA1)
   05164 Influenza A
    102179937 (Cahi-DQA1)
   05168 Herpes simplex virus 1 infection
    102179937 (Cahi-DQA1)
   05169 Epstein-Barr virus infection
    102179937 (Cahi-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102179937 (Cahi-DQA1)
   05140 Leishmaniasis
    102179937 (Cahi-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102179937 (Cahi-DQA1)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102179937 (Cahi-DQA1)
  Exosomal proteins of epithelial cells
   102179937 (Cahi-DQA1)
  Exosomal proteins of breast milk
   102179937 (Cahi-DQA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 I-set SKG6
Other DBs
NCBI-GeneID: 102179937
NCBI-ProteinID: XP_005701637
UniProt: A0A452EGD3
LinkDB
Position
23
AA seq 255 aa
MILNRALILGALALTTMMSPSGSEDIVADHIGIYGVNVYQTYGPSGYFTHEFDGDEEFYV
DLEKRETVWRLPEFSKFTSFDPQGALRNIATAKHNLEILIQRSNSTAATNKVPEVTVFSK
SPVMLGQPNTLICHVDNIFPPVINITWLRNGHSVTEGVSETSFLIKSDYSFLKINYLTFL
ASDDDVYDCKVEHWGLDEPVLKHWEPEIPVPMSELTETVVCALGLTVGLVGIVVGTVLII
RGLRSGGPSRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctgaacagagccctgattctgggggccctggccctgaccaccatgatgagtccc
tctgggagtgaagacattgtggctgaccacattggcatctatggcgtaaacgtctaccaa
acatatggtccctctggctactttacccatgaatttgatggagatgaagagttctacgtg
gacctggaaaagagggagactgtctggcgtctgcctgagtttagtaaatttacaagtttt
gaccctcagggtgcactgagaaacatagctacggcgaaacataatttggagatcttgatt
caaaggtccaactctactgctgctaccaacaaggttcctgaggtgactgtgttttccaag
tctcccgtgatgctgggtcaacccaacaccctcatctgtcacgtggacaacatctttccc
cctgtgatcaacatcacatggctgaggaacgggcactcggtcacagagggagtttctgag
accagttttctcatcaagagtgattattcttttctcaagatcaattatctcaccttcctc
gcttctgatgatgatgtttatgactgcaaagtggagcactggggtctggatgagccagtt
ctgaaacactgggagcctgagattccagtccctatgtcagagctgacagagactgtggtc
tgtgccctggggttgaccgtgggcctcgtgggcatcgtggtgggcaccgtcctcatcatc
cgaggtctgcgctcaggtggcccctccagacaccaggggccattgtga

KEGG   Capra hircus (goat): 102180664
Entry
102180664         CDS       T02910                                 

Definition
(RefSeq) boLa class II histocompatibility antigen, DQB*0101 beta chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102180664
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102180664
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102180664
   04612 Antigen processing and presentation
    102180664
   04658 Th1 and Th2 cell differentiation
    102180664
   04659 Th17 cell differentiation
    102180664
   04672 Intestinal immune network for IgA production
    102180664
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102180664
   05322 Systemic lupus erythematosus
    102180664
   05323 Rheumatoid arthritis
    102180664
   05320 Autoimmune thyroid disease
    102180664
   05321 Inflammatory bowel disease
    102180664
   05330 Allograft rejection
    102180664
   05332 Graft-versus-host disease
    102180664
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102180664
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102180664
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102180664
   05152 Tuberculosis
    102180664
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102180664
   05164 Influenza A
    102180664
   05168 Herpes simplex virus 1 infection
    102180664
   05169 Epstein-Barr virus infection
    102180664
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102180664
   05140 Leishmaniasis
    102180664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102180664
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102180664
  Exosomal proteins of epithelial cells
   102180664
  Exosomal proteins of breast milk
   102180664
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 MHC_I
Other DBs
NCBI-GeneID: 102180664
NCBI-ProteinID: XP_017894414
UniProt: A0A452EUH0
LinkDB
Position
23
AA seq 261 aa
MSGMVALQIPRGLWTAAVMVTLVVLSTPGAEGRDSPQDFLVQFKAQCYFTNGTERVRYVT
RYIYNREEYVRFDSDWDKYRAVTPLGRPDAEYWNSQEDFLEQTRAEADTVCRHNYQAELI
TSLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCRVEHPSLQSPIMVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRHRSQKGLVR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctgggatggtggctctgcagatccccagaggcctttggacagcagctgtgatggtg
accctggtggtgctgagcaccccaggggccgagggcagagactcgccacaggatttcctg
gtccagtttaaggcccagtgttacttcaccaacgggacggagcgggtgcggtacgtgacc
agatacatctacaaccgggaggagtacgtgcgcttcgacagcgactgggacaagtaccgg
gcggtgacgccgctggggcggccggacgccgagtactggaacagccaggaggacttcctg
gagcagacgcgggccgaggcggacacggtgtgcagacacaactaccaggcggagctcatc
acctccttgcagcggcgagtggaacctacagtgaccatctccccgtccaggactgaggct
ctaaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaag
gttcggtggttccggaatgaccaggaggagacagctggagttgtgtccacacctcttatt
aggaacggggactggaccttccagatcctggtgatgctggaaatgacccctcagcgagga
gatgtctacacctgccgcgtggagcaccccagcctccagagccccatcatggtggagtgg
cgggcgcagtctgaatctgcccagagcaagatgctgagtggtgttgggggcttcgtgctg
gggctgatcttcctcgggctgggcctcattatccgtcacaggagccagaaggggctcgtg
cgctga

KEGG   Capra hircus (goat): 102186442
Entry
102186442         CDS       T02910                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102186442
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102186442
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102186442
   04612 Antigen processing and presentation
    102186442
   04658 Th1 and Th2 cell differentiation
    102186442
   04659 Th17 cell differentiation
    102186442
   04672 Intestinal immune network for IgA production
    102186442
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102186442
   05322 Systemic lupus erythematosus
    102186442
   05323 Rheumatoid arthritis
    102186442
   05320 Autoimmune thyroid disease
    102186442
   05321 Inflammatory bowel disease
    102186442
   05330 Allograft rejection
    102186442
   05332 Graft-versus-host disease
    102186442
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102186442
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102186442
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102186442
   05152 Tuberculosis
    102186442
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102186442
   05164 Influenza A
    102186442
   05168 Herpes simplex virus 1 infection
    102186442
   05169 Epstein-Barr virus infection
    102186442
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102186442
   05140 Leishmaniasis
    102186442
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102186442
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102186442
  Exosomal proteins of epithelial cells
   102186442
  Exosomal proteins of breast milk
   102186442
SSDB
Motif
Pfam: MHC_II_beta C1-set Psg1 ig Marek_A
Other DBs
NCBI-GeneID: 102186442
NCBI-ProteinID: XP_017894808
LinkDB
Position
23
AA seq 260 aa
MVCLWYPPGSWTVILPVILMVLSPLLAWAGNTRTLFMVQGKSECHFSNGTQQVRFLDRYI
YNREELVRFDSLVGEYRARTEMGRPAAERWNRWPDAPQRARAAGHDFCASNYEFFASRTV
QRRVEPTVTVYPVKSRPLWHHNLLVCSVNGFYPGHIEVKWFQNGQEEEAGVVSTGLIPNG
DWTFQIMVMLEIVPQGGEVYTCHVEHPSRMSPVTAEWRAQDESSKEKMLSGIGACVLGLL
FLGMGLLFYIRRSPELEQRP
NT seq 783 nt   +upstreamnt  +downstreamnt
atggtgtgcctttggtaccccccaggctcctggacagtaattctgccagtgatactgatg
gtgctgagccctctcctggcttgggctggaaacacccgaacactcttcatggtgcagggc
aagtccgagtgtcacttctccaacggcacgcagcaggtgcgcttcctggacaggtacatc
tacaaccgcgaggagctggtgcgcttcgacagcctcgtgggcgagtaccgggcgcggacc
gagatggggcggccggcggccgagcgctggaaccgctggcccgacgccccgcagcgggcg
cgcgccgccgggcacgacttctgcgccagcaactacgagttctttgcaagccgcacggtg
cagaggagagttgagcctacggtgactgtgtatcctgtaaagagtcggcctctatggcac
cacaacctcctggtctgctctgtgaatggtttctaccctggccacattgaagtcaagtgg
ttccagaatggccaggaagaggaggccggggtggtctccacaggcctgatccctaatgga
gactggactttccagatcatggtgatgcttgaaatagttcctcagggtggagaggtctac
acctgccacgtggagcaccccagccggatgagccctgtaacagcagaatggagggcacag
gacgaatcttcaaaagaaaagatgctgagtggaatcggggcctgtgttctgggtctgctc
ttccttgggatggggctgctcttctacatcaggaggtctcctgagctggagcagagacca
tga

KEGG   Capra hircus (goat): 102186727
Entry
102186727         CDS       T02910                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102186727
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102186727
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102186727
   04612 Antigen processing and presentation
    102186727
   04658 Th1 and Th2 cell differentiation
    102186727
   04659 Th17 cell differentiation
    102186727
   04672 Intestinal immune network for IgA production
    102186727
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102186727
   05322 Systemic lupus erythematosus
    102186727
   05323 Rheumatoid arthritis
    102186727
   05320 Autoimmune thyroid disease
    102186727
   05321 Inflammatory bowel disease
    102186727
   05330 Allograft rejection
    102186727
   05332 Graft-versus-host disease
    102186727
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102186727
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102186727
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102186727
   05152 Tuberculosis
    102186727
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102186727
   05164 Influenza A
    102186727
   05168 Herpes simplex virus 1 infection
    102186727
   05169 Epstein-Barr virus infection
    102186727
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102186727
   05140 Leishmaniasis
    102186727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102186727
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102186727
  Exosomal proteins of epithelial cells
   102186727
  Exosomal proteins of breast milk
   102186727
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 102186727
NCBI-ProteinID: XP_005696261
LinkDB
Position
23
AA seq 298 aa
MKKALILRALALAAMMSPCGGEDIVADHVGTYGTNVYQTYGASGQFTFEFDGDELFYVDL
RKKETVWRLPEFNNITMFEIQSALRNIVMSKRNLDILMKNSNFTPATNDIPEVAVFPKSS
VALGIPNTLICQVDNIFPPVINITWFYNGQFVAEGVAETTFYPKSDHSFLKFSYLTFLPA
SEDFYDCRVEHWGLEEPLVKHWEPKIPTPTSELTETVVCALGLPMGLMGIVAGTVLILRV
RCSGAASRRRRAMSHGLKDGKHREHRTISLMLLGVSGDQSLQEKKGVVQTPVPHLDLD
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaagaaagctctgattctgagggctctcgctctggccgccatgatgagcccctgtgga
ggtgaagacatcgtggcggaccatgtgggcacttatggcacaaatgtctaccagacgtac
ggcgcctctggccagttcacgtttgaatttgatggagacgagctcttctacgtggacctg
aggaaaaaagagactgtctggaggctgcccgagtttaacaatatcaccatgtttgaaatt
caaagtgccctgagaaacattgttatgtcaaaaagaaatttggacatcttgatgaaaaat
tccaactttacacctgccaccaacgacatccctgaagtggctgtgtttcccaaatcctct
gtggccctggggattcccaacaccctcatctgtcaagtggacaacatctttcctcctgtg
atcaacatcacttggttttacaatggacaatttgttgcagaaggtgtcgctgagaccacc
ttctaccccaagagtgaccactccttcctcaagttcagttacctcacctttcttcccgcc
agtgaagacttctatgactgcagagtggagcactggggcctggaagagcccctcgtcaag
cactgggagcccaagattccaacccctacatcagagctgacagagactgtggtctgtgcc
ctggggttgcccatgggcctcatgggcatcgtggcgggcactgtcctcatcctccgagtc
cggtgctcaggtgctgcctccagacgtcgaagggccatgagtcatggcctgaaagatggg
aagcatcgggagcacaggaccatcagcctcatgctacttggtgtttcaggtgatcagtct
ttacaagaaaagaaaggcgtggttcagactccagttccccatcttgaccttgactga

KEGG   Capra hircus (goat): 102187356
Entry
102187356         CDS       T02910                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102187356
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102187356
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102187356
   04612 Antigen processing and presentation
    102187356
   04658 Th1 and Th2 cell differentiation
    102187356
   04659 Th17 cell differentiation
    102187356
   04672 Intestinal immune network for IgA production
    102187356
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102187356
   05322 Systemic lupus erythematosus
    102187356
   05323 Rheumatoid arthritis
    102187356
   05320 Autoimmune thyroid disease
    102187356
   05321 Inflammatory bowel disease
    102187356
   05330 Allograft rejection
    102187356
   05332 Graft-versus-host disease
    102187356
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102187356
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102187356
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102187356
   05152 Tuberculosis
    102187356
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102187356
   05164 Influenza A
    102187356
   05168 Herpes simplex virus 1 infection
    102187356
   05169 Epstein-Barr virus infection
    102187356
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102187356
   05140 Leishmaniasis
    102187356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102187356
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102187356
  Exosomal proteins of epithelial cells
   102187356
  Exosomal proteins of breast milk
   102187356
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig C2-set_2
Other DBs
NCBI-GeneID: 102187356
NCBI-ProteinID: XP_005696263
LinkDB
Position
23
AA seq 285 aa
MEIFLSCLLSSRMSPIWVPWVVAFSSTVLRLDASMTQGRDSPEDFVTQAKADCYFTNGTE
KVRFVVRFIFNLEEYARFDSDLGMFVALTELGKPDAELWNNRPDILARSRASVDMLCRRN
YNLGAPFTVGRRVQPEVTVYPEKTPALQHRNLLLCLVTGFYPGDIKVTWFRNGQEQREGV
MSTGLIRNGDWTFQTTVMLPMTPELGEVYTCLVDHPSLPSPVSVEWRAQSEYSWRKMLSG
AAAFLVGLVFFLVGIAIHIRARKGHVETPLLGNEVPRAVLPPQPH
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagattttcctgtcttgtttgctttcttccagaatgagtcctatttgggttccctgg
gtggtggccttctcatccacggttctcaggctggatgcttctatgactcaaggcagagat
tctccagaagattttgtgacccaggcaaaggctgactgttacttcaccaatgggacagaa
aaggtgcggtttgtggtcagattcatcttcaacctggaggagtatgcacgtttcgacagc
gacttgggaatgtttgtggccttgacggagctgggcaagcccgatgctgagctgtggaac
aatcggccagatatactggcgaggagtagagcctctgtggacatgctttgcagacgcaac
tacaatctgggagcacccttcaccgtggggaggagagtgcaaccagaggtgacagtgtat
ccggagaagaccccagccctgcagcaccgcaatctgctgctttgcttggtgacaggtttc
tacccaggggacatcaaggtcacctggttccggaatgggcaggaacaaagagagggggtc
atgtccaccggcctcatcaggaatggagactggacctttcagacgacggtgatgctgccc
atgacgcctgagcttggagaggtctacacctgccttgttgaccatcccagcttgccgagc
cctgtttctgtggagtggagagctcagtctgaatattcttggagaaagatgctgagtgga
gctgcagccttcctggtcgggctagtcttctttctggtgggaattgccatccacatcagg
gcccggaaaggacatgtggagactccgttgcttggcaatgaggtcccaagagcagtgctt
ccaccacagccgcactag

KEGG   Capra hircus (goat): 102187998
Entry
102187998         CDS       T02910                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102187998
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102187998
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102187998
   04612 Antigen processing and presentation
    102187998
   04658 Th1 and Th2 cell differentiation
    102187998
   04659 Th17 cell differentiation
    102187998
   04672 Intestinal immune network for IgA production
    102187998
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102187998
   05322 Systemic lupus erythematosus
    102187998
   05323 Rheumatoid arthritis
    102187998
   05320 Autoimmune thyroid disease
    102187998
   05321 Inflammatory bowel disease
    102187998
   05330 Allograft rejection
    102187998
   05332 Graft-versus-host disease
    102187998
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102187998
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102187998
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102187998
   05152 Tuberculosis
    102187998
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102187998
   05164 Influenza A
    102187998
   05168 Herpes simplex virus 1 infection
    102187998
   05169 Epstein-Barr virus infection
    102187998
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102187998
   05140 Leishmaniasis
    102187998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102187998
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102187998
  Exosomal proteins of epithelial cells
   102187998
  Exosomal proteins of breast milk
   102187998
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_3 Ig_2 ig C2-set_2
Other DBs
NCBI-GeneID: 102187998
NCBI-ProteinID: XP_005696266
UniProt: A0A452G7S1
LinkDB
Position
23
AA seq 262 aa
MTVLLPLLLGLSLGCTGAGGFVAHVESTCLLDDDGSPKEFTYCVSFNKDLLTCWDPLQAS
MVPREFGVLNGLAKYLSDSLNSDDVLIQRLSSGLQDCAVHTQPFWSSLTHRTRPPTVQVA
RTTPFNTRESVMLACYVWGFYPADVAITWRRNGQEVLPHGTAWRVIQPNGDWTYQTVSHL
ATTPSFGDTYTCVVEHIGAPELILQDWTPGLLPVQAVKVSLSLVTLVLGFIVFVFGLRSW
QRAASSGYIFLPGSTYPEGHHD
NT seq 789 nt   +upstreamnt  +downstreamnt
atgactgtcctcttgccgctgctgctgggcctcagcctgggctgcaccggagcaggtggc
tttgtggcacacgtggaaagcacctgtctgttggacgatgatgggagtccaaaagagttc
acgtattgcgtctccttcaacaaggacttgctgacctgctgggatcccctgcaggccagt
atggttcctcgtgaatttggggtgctgaacggcttggccaagtacctctcagattccctc
aacagtgacgatgtcctgatccagcgcttgtccagtggtctgcaggactgtgccgtgcac
acccagcccttctggagctctctgacccacaggacacgcccgccgaccgtgcaggtagcc
agaaccactccttttaacacgagggagtctgtgatgctggcctgctacgtgtggggcttc
tacccagcggacgtggccatcacgtggaggaggaacgggcaggaggtcctcccacacggc
acagcctggagggtcatccagcccaatggagactggacgtaccagaccgtctcccacctg
gccacaaccccctcttttggggacacctacacctgtgtggtcgagcacattggggctcct
gaactcatccttcaggactggactcctgggctgttgcctgtgcaggcggtgaaggtttcc
ttgtctctggtaacgctggtcctgggcttcatcgtcttcgtttttggtctgcgcagttgg
cagagagccgcctcctccggctacattttcctcccggggtccacttatccagaaggtcat
cacgattga

KEGG   Capra hircus (goat): 102188267
Entry
102188267         CDS       T02910                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102188267
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102188267
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102188267
   04612 Antigen processing and presentation
    102188267
   04658 Th1 and Th2 cell differentiation
    102188267
   04659 Th17 cell differentiation
    102188267
   04672 Intestinal immune network for IgA production
    102188267
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102188267
   05322 Systemic lupus erythematosus
    102188267
   05323 Rheumatoid arthritis
    102188267
   05320 Autoimmune thyroid disease
    102188267
   05321 Inflammatory bowel disease
    102188267
   05330 Allograft rejection
    102188267
   05332 Graft-versus-host disease
    102188267
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102188267
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102188267
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102188267
   05152 Tuberculosis
    102188267
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188267
   05164 Influenza A
    102188267
   05168 Herpes simplex virus 1 infection
    102188267
   05169 Epstein-Barr virus infection
    102188267
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102188267
   05140 Leishmaniasis
    102188267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102188267
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102188267
  Exosomal proteins of epithelial cells
   102188267
  Exosomal proteins of breast milk
   102188267
SSDB
Motif
Pfam: MHC_II_alpha C1-set FAST_1 SKG6 Ig_2
Other DBs
NCBI-GeneID: 102188267
NCBI-ProteinID: XP_005696267
LinkDB
Position
23
AA seq 261 aa
MDRGPSQETALLRLLSFLWLLPLSWTAPEAPAPGWTDDLQNHTLLHTVYCQDWSPSVGLS
EAYDGDQLFSFDFSQNIRVPRLPEFADWAHQHGDTSNIMFDKGFCRTMIEEIGPQLEGKI
PVSRGFPIVQVFTLKPLEFGKPNTLVCFISNLFPPTLTVEWQHQSAPVEGVGPTFVSAVD
GLTFQAFSYLNFTPESSDLFSCIVTHEIDGYTAIAFWVPQNALPSDLLENVLCGVAFGLG
VLGITVGVVLIIYSRKPCSGG
NT seq 786 nt   +upstreamnt  +downstreamnt
atggaccgtgggccgagccaggaaactgcgctgctacggctgctctcctttctgtggctg
ctgcccctgtcctggaccgcccctgaagctcctgctccagggtggacggatgacctgcaa
aaccacacgctcctgcacacagtgtattgccaggactggagccccagtgtggggctctct
gaggcctacgacggggaccagcttttctccttcgacttttcccagaacatccgagtgcct
cgcttgcctgaatttgctgactgggctcaccagcacggagatacctccaacattatgttt
gacaaaggtttttgccggaccatgatcgaggaaattggcccacaacttgaagggaagatc
cctgtgtctagagggttccccattgttcaggtgttcacactgaagcccctggagtttggc
aagcccaacacgctggtctgtttcatcagtaacctctttccacccacactgaccgtggag
tggcagcatcagtcggcgcccgtggaaggagtcgggcccacttttgtctctgcggttgat
ggactcaccttccaggccttttcctacctaaacttcacaccagaatcctctgatcttttt
tcttgcatcgtgactcatgagatcgatggctacacagcaatcgctttttgggtgccccag
aacgcgctgccctctgatcttctggagaatgtgctgtgcggcgtggcttttggcctgggt
gtgctgggcatcactgttggcgtggtccttatcatctactcccggaagccgtgctcaggg
ggctga

KEGG   Capra hircus (goat): 102188986
Entry
102188986         CDS       T02910                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102188986
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102188986
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102188986
   04612 Antigen processing and presentation
    102188986
   04658 Th1 and Th2 cell differentiation
    102188986
   04659 Th17 cell differentiation
    102188986
   04672 Intestinal immune network for IgA production
    102188986
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102188986
   05322 Systemic lupus erythematosus
    102188986
   05323 Rheumatoid arthritis
    102188986
   05320 Autoimmune thyroid disease
    102188986
   05321 Inflammatory bowel disease
    102188986
   05330 Allograft rejection
    102188986
   05332 Graft-versus-host disease
    102188986
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102188986
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102188986
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102188986
   05152 Tuberculosis
    102188986
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188986
   05164 Influenza A
    102188986
   05168 Herpes simplex virus 1 infection
    102188986
   05169 Epstein-Barr virus infection
    102188986
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102188986
   05140 Leishmaniasis
    102188986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102188986
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102188986
  Exosomal proteins of epithelial cells
   102188986
  Exosomal proteins of breast milk
   102188986
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102188986
NCBI-ProteinID: XP_013829269
LinkDB
Position
23
AA seq 250 aa
MVLRGRLVLGLHTLMTLLSPQEVGAIKADHMGSYGPAFYQSYDGAGQFTYDFDGEQLFSV
DLKKREAVWRLPEFGNFAYFDPQNGLVSIAMIKAHLEVLVERSNGTRAPNVPPRVAVLPK
SRVQLGEPNVLICIVDNIFPPVINVTWLRNGQPITQGVTQTSFYAQPDHSFRKFHYLTFV
PLADDFYDCKVEHWGLDQPLFQHWEPQVPTVLPDTTGTLVCALGLILGLGGFLGGITLII
TGTCLSSAPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctcagggggaggctggtcctgggactgcacaccctgatgaccctcctgagcccc
caggaagttggggccatcaaggctgaccacatgggttcctatggaccagccttctaccag
tcctatgacggtgcaggtcagttcacctatgattttgatggagaacagctgttctctgtg
gacctgaagaagagggaggctgtgtggcgtctgcctgaatttggcaacttcgcctacttt
gacccgcagaacgggctggtcagtatcgcgatgatcaaagcgcatctggaggtcttggtg
gagcgctccaacggcaccagagcccccaacgtgccccccagagtggctgtgctgcccaag
tctcgggtgcagctgggcgagcccaacgtcctcatctgcatcgtggacaacatcttcccc
ccggtcatcaacgtcacctggctgcgcaacggccagcccatcacccagggcgtgacccag
accagcttctacgcccagcctgaccactcgttccggaagttccactacttgacctttgtg
cccttggcagacgacttctatgactgcaaggtggagcactggggcctggaccagccactc
tttcagcactgggagccccaggtgcccaccgtgctgcctgacaccacagggactctggtc
tgtgcccttggcctgatcctcggcctggggggcttcctcgggggcatcaccctcatcatc
acaggcacgtgcctgtccagtgcccccaggtga

KEGG   Capra hircus (goat): 102189356
Entry
102189356         CDS       T02910                                 

Gene name
DRA
Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102189356 (DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102189356 (DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102189356 (DRA)
   04612 Antigen processing and presentation
    102189356 (DRA)
   04658 Th1 and Th2 cell differentiation
    102189356 (DRA)
   04659 Th17 cell differentiation
    102189356 (DRA)
   04672 Intestinal immune network for IgA production
    102189356 (DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102189356 (DRA)
   05322 Systemic lupus erythematosus
    102189356 (DRA)
   05323 Rheumatoid arthritis
    102189356 (DRA)
   05320 Autoimmune thyroid disease
    102189356 (DRA)
   05321 Inflammatory bowel disease
    102189356 (DRA)
   05330 Allograft rejection
    102189356 (DRA)
   05332 Graft-versus-host disease
    102189356 (DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102189356 (DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102189356 (DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102189356 (DRA)
   05152 Tuberculosis
    102189356 (DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102189356 (DRA)
   05164 Influenza A
    102189356 (DRA)
   05168 Herpes simplex virus 1 infection
    102189356 (DRA)
   05169 Epstein-Barr virus infection
    102189356 (DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102189356 (DRA)
   05140 Leishmaniasis
    102189356 (DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102189356 (DRA)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102189356 (DRA)
  Exosomal proteins of epithelial cells
   102189356 (DRA)
  Exosomal proteins of breast milk
   102189356 (DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 102189356
NCBI-ProteinID: NP_001301117
UniProt: O19810
LinkDB
Position
23
AA seq 253 aa
MAITRVPILGLFITVLISLQELWAIKEDHVIIQAEFYLNPEQSAEFMFDFDGDEIFHVDM
QKKETVWRLPEFGRFASFEAQGALANMAVMKANLDIMIKRSNNTPNTNVPPEVTLLPNKP
VELGEPNTLICFIDKFSPPVISVTWLRNGIPVTDGVSQTVFLPRDDHLFRKFHYLPFLPT
TEDVYDCKVEHWGLNEPLLKHWEYEAPAPLPETTENAVCALGLIVALVGIIAGTIFIIKG
VRKANTVERRGPL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccataaccagggtcccaatattaggacttttcatcactgtcctgatcagcctacag
gaattgtgggctattaaagaggaccatgtgatcatccaggctgagttctatctgaaccct
gagcaatcagccgagtttatgtttgactttgatggtgatgagattttccacgtggatatg
cagaagaaggagacagtgtggcggcttccagaatttggacgttttgccagctttgaggct
cagggtgccctggccaatatggctgtgatgaaagccaacctggacatcatgataaagcgc
tccaacaacaccccgaacaccaatgttcctccagaagtgactctgctcccaaacaagcct
gtggaactgggagagcccaacacactcatctgcttcattgacaagttctcaccacccgtg
atcagtgtcacgtggcttcgaaatggcatacctgtcactgacggagtgtcacagacggtc
ttcctgcccagggatgaccaccttttccgcaagttccactacctccccttcctgcccaca
acagaggatgtctatgactgcaaggtggagcactggggtctgaacgagcctcttctcaag
cactgggagtatgaagctccagcccctctcccagagacgacagagaatgcagtgtgtgcc
ctgggcctgattgtggctctggtgggcatcattgcagggaccatcttcatcatcaagggc
gtgcgcaaagccaacactgttgaacgccgagggcctctgtga

KEGG   Capra hircus (goat): 102190745
Entry
102190745         CDS       T02910                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102190745
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102190745
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102190745
   04612 Antigen processing and presentation
    102190745
   04658 Th1 and Th2 cell differentiation
    102190745
   04659 Th17 cell differentiation
    102190745
   04672 Intestinal immune network for IgA production
    102190745
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102190745
   05322 Systemic lupus erythematosus
    102190745
   05323 Rheumatoid arthritis
    102190745
   05320 Autoimmune thyroid disease
    102190745
   05321 Inflammatory bowel disease
    102190745
   05330 Allograft rejection
    102190745
   05332 Graft-versus-host disease
    102190745
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102190745
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102190745
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102190745
   05152 Tuberculosis
    102190745
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102190745
   05164 Influenza A
    102190745
   05168 Herpes simplex virus 1 infection
    102190745
   05169 Epstein-Barr virus infection
    102190745
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102190745
   05140 Leishmaniasis
    102190745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102190745
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102190745
  Exosomal proteins of epithelial cells
   102190745
  Exosomal proteins of breast milk
   102190745
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I
Other DBs
NCBI-GeneID: 102190745
NCBI-ProteinID: XP_017894576
LinkDB
Position
23
AA seq 255 aa
MAALAVLLMVLSPPFSWARETQSLFMHQFKGECRFSNGLERMRFFARYIYNTKEDVHFDS
DVGEFTALTELGRPDAEYWNQQKDFMEQMRAKVDTVCRSNYQGIGSFLRQRRVEPAVTVY
PAKTQPLQHHSLLVCSVNGFYPGHIEVRWFRNGHEEEAGVISTGLIQNGDWTFQTVVMLE
TVPQGGEVYTCQVEHPSRTSPLTVEWRAQSDSAQRKLISGVGGFVLGLLFLGVGLFIHFR
SKKGHPALQPIGPLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcagctttggcagtgctactgatggtgctcagccctcccttctcttgggccagggaa
acccaatcccttttcatgcatcagtttaagggtgagtgtcgtttctccaacgggttggag
cggatgcggttctttgccagatacatctacaacacgaaggaggatgtgcacttcgacagc
gatgtgggggagttcacggccctgacggagctggggaggccggacgccgagtactggaac
cagcaaaaggacttcatggagcagatgcgggccaaggtggacacggtgtgcagatccaac
taccagggcattggtagcttcctgaggcagcgccgagtggagcctgcagtgactgtgtat
cctgcaaagacccagcccctgcagcaccacagcctcctggtctgctctgtgaatggattc
tacccaggccacattgaagtcaggtggttccggaacggccacgaagaggaggctggggtg
atctccacaggcctgatccagaatggagactggaccttccagaccgtggtgatgcttgaa
acagttcctcagggtggagaggtctacacctgccaagtggagcaccccagccggacgagc
cctctcacagtggaatggagagcacagtctgactctgctcagaggaagctgataagtgga
gttggaggctttgttctgggtctgctcttccttggtgtggggctgttcatccatttcagg
agtaagaaaggacaccctgcacttcagcctataggacccctgagctga

KEGG   Capra hircus (goat): 106503481
Entry
106503481         CDS       T02910                                 

Definition
(RefSeq) rano class II histocompatibility antigen, A beta chain-like
  KO
K06752  MHC class II antigen
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04672  Intestinal immune network for IgA production
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106503481
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106503481
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106503481
   04612 Antigen processing and presentation
    106503481
   04658 Th1 and Th2 cell differentiation
    106503481
   04659 Th17 cell differentiation
    106503481
   04672 Intestinal immune network for IgA production
    106503481
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    106503481
   05322 Systemic lupus erythematosus
    106503481
   05323 Rheumatoid arthritis
    106503481
   05320 Autoimmune thyroid disease
    106503481
   05321 Inflammatory bowel disease
    106503481
   05330 Allograft rejection
    106503481
   05332 Graft-versus-host disease
    106503481
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106503481
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106503481
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    106503481
   05152 Tuberculosis
    106503481
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106503481
   05164 Influenza A
    106503481
   05168 Herpes simplex virus 1 infection
    106503481
   05169 Epstein-Barr virus infection
    106503481
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106503481
   05140 Leishmaniasis
    106503481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    106503481
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106503481
  Exosomal proteins of epithelial cells
   106503481
  Exosomal proteins of breast milk
   106503481
SSDB
Motif
Pfam: MHC_II_beta C1-set MHC_I NHase_alpha MtrF
Other DBs
NCBI-GeneID: 106503481
NCBI-ProteinID: XP_017894806
UniProt: A0A452EF69
LinkDB
Position
23
AA seq 274 aa
MRVTIPRNPGTVAGMVMAVFLVLRIPEAHCREAPKNFVYQFKGMCYFTNGTEHVRLVARQ
IYNKEEILHFDSDLGEFVAVTELGRVCAEIWNTQKDLLAEFRAYVETLCRRNYKETVGST
VQRRVEPTVTVSPASTEAPNLHNLLVCSVTNFYPRQVKVKWFRNQQEQTAGVGFTPLTQN
GDWTYQIHMMLETIPQLGDIYVCHVDHPSLQSPITVEWRAQSESAQSKMRSGIGGFVLGL
IFLGVGLFVHFWDKRGKAPWEKKGKTGAGLKSLC
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagggtgaccatccccaggaaccctgggactgtggctggaatggtgatggctgtgttt
ctggtgctgaggatccccgaggctcactgcagagaggctccgaagaatttcgtgtaccag
tttaaaggcatgtgctacttcaccaatgggacggaacacgtgaggcttgtggccagacag
atctacaacaaggaagagatcctgcactttgacagcgacctgggcgagtttgtggctgtt
acagagctgggccgggtgtgtgctgagatctggaacacccagaaggacctcctggcggag
tttcgggcctacgtggagacgctgtgtagacgcaactacaaggagacggtcggctccact
gtccagcggagagtggagcctacagtgacggtctctccagccagtacagaggccccgaac
ctccataatctgctggtctgttcagtgacaaatttctatcctcgccaagttaaagtcaaa
tggttccggaatcaacaggagcagacagctggagttgggttcacacctcttactcagaat
ggggactggacctaccagattcacatgatgctagagacaataccacagcttggagacatc
tatgtttgccacgtggaccaccccagcctccagagccccatcacagtagaatggcgggca
cagtctgaatctgcccagagcaagatgcggagtggaattggaggttttgtgctggggctg
atcttccttggtgtgggcctttttgtccacttttgggataagagaggtaaggcgccttgg
gagaaaaaggggaagacaggtgctgggctgaaaagcctctgttga

DBGET integrated database retrieval system