Capra hircus (goat): 100860813 Help Entry 100860813         CDS       T02910                                  Gene name Cahi-DQA2 Definition (RefSeq) HA25   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     100860813 (Cahi-DQA2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100860813 (Cahi-DQA2)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100860813 (Cahi-DQA2)    04612 Antigen processing and presentation     100860813 (Cahi-DQA2)    04658 Th1 and Th2 cell differentiation     100860813 (Cahi-DQA2)    04659 Th17 cell differentiation     100860813 (Cahi-DQA2)    04672 Intestinal immune network for IgA production     100860813 (Cahi-DQA2)  09160 Human Diseases   09163 Immune disease    05310 Asthma     100860813 (Cahi-DQA2)    05322 Systemic lupus erythematosus     100860813 (Cahi-DQA2)    05323 Rheumatoid arthritis     100860813 (Cahi-DQA2)    05320 Autoimmune thyroid disease     100860813 (Cahi-DQA2)    05321 Inflammatory bowel disease     100860813 (Cahi-DQA2)    05330 Allograft rejection     100860813 (Cahi-DQA2)    05332 Graft-versus-host disease     100860813 (Cahi-DQA2)   09166 Cardiovascular disease    05416 Viral myocarditis     100860813 (Cahi-DQA2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100860813 (Cahi-DQA2)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     100860813 (Cahi-DQA2)    05152 Tuberculosis     100860813 (Cahi-DQA2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100860813 (Cahi-DQA2)    05164 Influenza A     100860813 (Cahi-DQA2)    05168 Herpes simplex virus 1 infection     100860813 (Cahi-DQA2)    05169 Epstein-Barr virus infection     100860813 (Cahi-DQA2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100860813 (Cahi-DQA2)    05140 Leishmaniasis     100860813 (Cahi-DQA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     100860813 (Cahi-DQA2) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100860813 (Cahi-DQA2)   Exosomal proteins of epithelial cells    100860813 (Cahi-DQA2)   Exosomal proteins of breast milk    100860813 (Cahi-DQA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 I-set SKG6 Motif Other DBs NCBI-GeneID:  100860813 NCBI-ProteinID:  NP_001272609 UniProt:  B2CZF2 LinkDB All DBs Position 23 AA seq 255 aa AA seqDB search MVLNRALILGALALTTMMSPSGGEDIVADHVGSYGTEIYQSHGPSGQYTQEFDGDEMFYV DLGKKETVWRLPMFSQFAGFDPQGALSEIATAKQNLDILTKHSNFTPAINEVPEVTVFSK SPVMLSQPNTLICHVDNIFPPVINITWLKNGHAVTEGVSETSFLPKDDHSFLKIGYLTFL PSDDDVYDCKVEHWGLDEPLLKHWEPETPAPMSELTETVVCALGLTVGLVGIVVGTIFII QGLRSGGASRHQGPL NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atggtcctgaacagagctctgattctgggggccctcgccctgaccaccatgatgagcccc agtggaggtgaagacattgtggctgaccacgttggctcctatggcacagagatctaccaa tctcatggtccctctggccagtacacccaggaatttgatggagacgagatgttttatgtg gacctggggaagaaggagactgtctggagactgcctatgtttagccagtttgcaggtttt gatccacagggtgcactgagtgaaatagctacagcaaaacaaaacttggatatcctgact aaacactccaactttacccctgctatcaatgaggttcctgaggtgactgtgttttccaag tctcccgtgatgctgagtcagcccaacaccctcatctgtcacgtggacaacattttcccc cctgtgatcaacatcacatggctgaagaacgggcatgcagtcacagagggtgtttctgag accagcttccttcccaaggatgatcattccttcctcaagattggttatctcaccttcctc ccttctgatgatgacgtttatgactgcaaagtggagcactggggcctggatgagccactt ctgaaacactgggagcctgagactccagcccctatgtcagagctgacggagactgtggtc tgtgccctggggttgaccgtgggccttgtgggcatcgtggtgggcaccatcttcatcatc caaggcctgcgctcaggtggggcctccagacaccagggtcccttgtga

Capra hircus (goat): 102173458 Help Entry 102173458         CDS       T02910                                  Gene name DRB*A Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102173458 (DRB*A)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102173458 (DRB*A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102173458 (DRB*A)    04612 Antigen processing and presentation     102173458 (DRB*A)    04658 Th1 and Th2 cell differentiation     102173458 (DRB*A)    04659 Th17 cell differentiation     102173458 (DRB*A)    04672 Intestinal immune network for IgA production     102173458 (DRB*A)  09160 Human Diseases   09163 Immune disease    05310 Asthma     102173458 (DRB*A)    05322 Systemic lupus erythematosus     102173458 (DRB*A)    05323 Rheumatoid arthritis     102173458 (DRB*A)    05320 Autoimmune thyroid disease     102173458 (DRB*A)    05321 Inflammatory bowel disease     102173458 (DRB*A)    05330 Allograft rejection     102173458 (DRB*A)    05332 Graft-versus-host disease     102173458 (DRB*A)   09166 Cardiovascular disease    05416 Viral myocarditis     102173458 (DRB*A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102173458 (DRB*A)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102173458 (DRB*A)    05152 Tuberculosis     102173458 (DRB*A)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102173458 (DRB*A)    05164 Influenza A     102173458 (DRB*A)    05168 Herpes simplex virus 1 infection     102173458 (DRB*A)    05169 Epstein-Barr virus infection     102173458 (DRB*A)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102173458 (DRB*A)    05140 Leishmaniasis     102173458 (DRB*A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102173458 (DRB*A) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102173458 (DRB*A)   Exosomal proteins of epithelial cells    102173458 (DRB*A)   Exosomal proteins of breast milk    102173458 (DRB*A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_2 vMSA DUF202 ig Motif Other DBs NCBI-GeneID:  102173458 NCBI-ProteinID:  NP_001301095 UniProt:  O19200 LinkDB All DBs AA seq 266 aa AA seqDB search MVCLYFSGGSRMAALIVMLMMLSPPLAWAREIQPHFLEYYKAECHFSNGTGRVRLLHRFY TNGEETVRFDSDWGEFRAVTEQGQEDAKYWNSQKDFLEQKRAEVDTVCRHNYGVLESFTV QRRVEPAVTVYPTKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNGHEEEAGVISTGLIQNG DWTFQTMVMLETVPQGGEVYTCQVEHPSRTSPITVEWRARSDSAQGKMMSGVGGFVLGLL FLAVGLFIYFRNQKGRPTLQPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgcctgtatttctctgggggctcccggatggcggctctgatagtgatgctgatg atgctgagccctcccctggcctgggccagggagatccaaccacatttcctggagtattat aaggccgagtgtcatttctccaacgggaccgggcgggtgcggttgctgcacagattctac actaatggagaagagaccgtgcgcttcgacagcgactggggcgagttccgggcggtgacc gagcaggggcaggaggacgccaagtactggaacagccagaaggacttcctggagcagaag cgggccgaggtggacacggtgtgcagacataactacggggtccttgagagtttcactgtg cagcggcgagtggagcctgcagtgactgtgtatcctacaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgaatggattctacccaggccacattgaagtcaggtgg ttccggaacggccacgaagaggaggctggggtgatctccacaggcctgatccagaatgga gactggaccttccagaccatggtgatgcttgaaacagttcctcagggtggagaggtctac acctgccaagtggagcaccccagccggacgagccctatcacagtagagtggagggcacgg tctgactcagctcagggcaagatgatgagtggagttgggggcttcgtgctgggcctgctc ttccttgcggtggggctcttcatctacttcaggaatcagaaaggacgccctacacttcag ccaacagggctcctgagctga

Capra hircus (goat): 102179660 Help Entry 102179660         CDS       T02910                                  Gene name Cahi-DRB1, DRB*B, DRB3 Definition (RefSeq) HLA class II histocompatibility antigen, DRB1-4 beta chain-like   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102179660 (Cahi-DRB1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102179660 (Cahi-DRB1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102179660 (Cahi-DRB1)    04612 Antigen processing and presentation     102179660 (Cahi-DRB1)    04658 Th1 and Th2 cell differentiation     102179660 (Cahi-DRB1)    04659 Th17 cell differentiation     102179660 (Cahi-DRB1)    04672 Intestinal immune network for IgA production     102179660 (Cahi-DRB1)  09160 Human Diseases   09163 Immune disease    05310 Asthma     102179660 (Cahi-DRB1)    05322 Systemic lupus erythematosus     102179660 (Cahi-DRB1)    05323 Rheumatoid arthritis     102179660 (Cahi-DRB1)    05320 Autoimmune thyroid disease     102179660 (Cahi-DRB1)    05321 Inflammatory bowel disease     102179660 (Cahi-DRB1)    05330 Allograft rejection     102179660 (Cahi-DRB1)    05332 Graft-versus-host disease     102179660 (Cahi-DRB1)   09166 Cardiovascular disease    05416 Viral myocarditis     102179660 (Cahi-DRB1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102179660 (Cahi-DRB1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102179660 (Cahi-DRB1)    05152 Tuberculosis     102179660 (Cahi-DRB1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102179660 (Cahi-DRB1)    05164 Influenza A     102179660 (Cahi-DRB1)    05168 Herpes simplex virus 1 infection     102179660 (Cahi-DRB1)    05169 Epstein-Barr virus infection     102179660 (Cahi-DRB1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102179660 (Cahi-DRB1)    05140 Leishmaniasis     102179660 (Cahi-DRB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102179660 (Cahi-DRB1) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102179660 (Cahi-DRB1)   Exosomal proteins of epithelial cells    102179660 (Cahi-DRB1)   Exosomal proteins of breast milk    102179660 (Cahi-DRB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_2 vMSA DUF202 ig Motif Other DBs NCBI-GeneID:  102179660 NCBI-ProteinID:  NP_001301146 UniProt:  O19201 LinkDB All DBs AA seq 266 aa AA seqDB search MVCLYFSRGSRMAALIVMLMVLSPPLAWARKIQPHFLRYCKRECHFSNGTERVGLLDRYF HNGEEIVRFDSDWGEFRAVTELGRPDAEYWNSQKEILESRRTAVDTYCRHNYGVVESFTV QRRVEPTVTVYPAKTQPLQHHNLLVCSVNGFYPGHIEVRWFRNSHEEEAGVISTGLIQNG DWTFQTMVMLETVPQSGEVYTCQVEHPSRTSPITVEWRARSDSAQSKMMSGVGGFVLGLL FLAVGLFIYFRNQKGRPTLQPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgcctgtatttctccagaggctcccggatggcagctctgatagtgatgctgatg gtgctgagccctcccctggcctgggccaggaagatccaaccacatttcctgaggtattgt aagagagagtgtcatttctccaacgggaccgagcgggtggggcttctggacagatacttc cataatggagaagagatcgtgcgcttcgacagcgactggggcgagttccgggcagtgacc gagctggggcggccggatgccgagtactggaacagccagaaggagatcctggagagcagg aggaccgcggtggacacgtactgcagacacaactacggggtcgttgagagtttcactgtg cagcggcgagtggagcctacagtgactgtgtatcctgcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgaatggattctacccaggccacattgaagtcaggtgg ttccggaacagccatgaagaggaggctggagtgatctccacaggcctgatccagaatgga gactggaccttccagaccatggtgatgcttgaaacagttcctcagagtggagaggtctac acctgccaagtggagcaccccagccggacgagccctatcacagtagaatggagggcacgg tctgactcagctcagagcaagatgatgagtggagtcgggggcttcgtgctgggtctgctc ttccttgcggtggggctcttcatctacttcaggaatcagaaaggacgccctacccttcag ccaacagggctcctgagctga

Capra hircus (goat): 102179937 Help Entry 102179937         CDS       T02910                                  Gene name Cahi-DQA1 Definition (RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102179937 (Cahi-DQA1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102179937 (Cahi-DQA1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102179937 (Cahi-DQA1)    04612 Antigen processing and presentation     102179937 (Cahi-DQA1)    04658 Th1 and Th2 cell differentiation     102179937 (Cahi-DQA1)    04659 Th17 cell differentiation     102179937 (Cahi-DQA1)    04672 Intestinal immune network for IgA production     102179937 (Cahi-DQA1)  09160 Human Diseases   09163 Immune disease    05310 Asthma     102179937 (Cahi-DQA1)    05322 Systemic lupus erythematosus     102179937 (Cahi-DQA1)    05323 Rheumatoid arthritis     102179937 (Cahi-DQA1)    05320 Autoimmune thyroid disease     102179937 (Cahi-DQA1)    05321 Inflammatory bowel disease     102179937 (Cahi-DQA1)    05330 Allograft rejection     102179937 (Cahi-DQA1)    05332 Graft-versus-host disease     102179937 (Cahi-DQA1)   09166 Cardiovascular disease    05416 Viral myocarditis     102179937 (Cahi-DQA1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102179937 (Cahi-DQA1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102179937 (Cahi-DQA1)    05152 Tuberculosis     102179937 (Cahi-DQA1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102179937 (Cahi-DQA1)    05164 Influenza A     102179937 (Cahi-DQA1)    05168 Herpes simplex virus 1 infection     102179937 (Cahi-DQA1)    05169 Epstein-Barr virus infection     102179937 (Cahi-DQA1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102179937 (Cahi-DQA1)    05140 Leishmaniasis     102179937 (Cahi-DQA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102179937 (Cahi-DQA1) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102179937 (Cahi-DQA1)   Exosomal proteins of epithelial cells    102179937 (Cahi-DQA1)   Exosomal proteins of breast milk    102179937 (Cahi-DQA1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 I-set SKG6 Motif Other DBs NCBI-GeneID:  102179937 NCBI-ProteinID:  XP_005701637 UniProt:  A0A452EGD3 LinkDB All DBs Position 23 AA seq 255 aa AA seqDB search MILNRALILGALALTTMMSPSGSEDIVADHIGIYGVNVYQTYGPSGYFTHEFDGDEEFYV DLEKRETVWRLPEFSKFTSFDPQGALRNIATAKHNLEILIQRSNSTAATNKVPEVTVFSK SPVMLGQPNTLICHVDNIFPPVINITWLRNGHSVTEGVSETSFLIKSDYSFLKINYLTFL ASDDDVYDCKVEHWGLDEPVLKHWEPEIPVPMSELTETVVCALGLTVGLVGIVVGTVLII RGLRSGGPSRHQGPL NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atgatcctgaacagagccctgattctgggggccctggccctgaccaccatgatgagtccc tctgggagtgaagacattgtggctgaccacattggcatctatggcgtaaacgtctaccaa acatatggtccctctggctactttacccatgaatttgatggagatgaagagttctacgtg gacctggaaaagagggagactgtctggcgtctgcctgagtttagtaaatttacaagtttt gaccctcagggtgcactgagaaacatagctacggcgaaacataatttggagatcttgatt caaaggtccaactctactgctgctaccaacaaggttcctgaggtgactgtgttttccaag tctcccgtgatgctgggtcaacccaacaccctcatctgtcacgtggacaacatctttccc cctgtgatcaacatcacatggctgaggaacgggcactcggtcacagagggagtttctgag accagttttctcatcaagagtgattattcttttctcaagatcaattatctcaccttcctc gcttctgatgatgatgtttatgactgcaaagtggagcactggggtctggatgagccagtt ctgaaacactgggagcctgagattccagtccctatgtcagagctgacagagactgtggtc tgtgccctggggttgaccgtgggcctcgtgggcatcgtggtgggcaccgtcctcatcatc cgaggtctgcgctcaggtggcccctccagacaccaggggccattgtga

Capra hircus (goat): 102180664 Help Entry 102180664         CDS       T02910                                  Definition (RefSeq) boLa class II histocompatibility antigen, DQB*0101 beta chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102180664  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102180664  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102180664    04612 Antigen processing and presentation     102180664    04658 Th1 and Th2 cell differentiation     102180664    04659 Th17 cell differentiation     102180664    04672 Intestinal immune network for IgA production     102180664  09160 Human Diseases   09163 Immune disease    05310 Asthma     102180664    05322 Systemic lupus erythematosus     102180664    05323 Rheumatoid arthritis     102180664    05320 Autoimmune thyroid disease     102180664    05321 Inflammatory bowel disease     102180664    05330 Allograft rejection     102180664    05332 Graft-versus-host disease     102180664   09166 Cardiovascular disease    05416 Viral myocarditis     102180664   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102180664   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102180664    05152 Tuberculosis     102180664   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102180664    05164 Influenza A     102180664    05168 Herpes simplex virus 1 infection     102180664    05169 Epstein-Barr virus infection     102180664   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102180664    05140 Leishmaniasis     102180664  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102180664 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102180664   Exosomal proteins of epithelial cells    102180664   Exosomal proteins of breast milk    102180664 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 MHC_I Motif Other DBs NCBI-GeneID:  102180664 NCBI-ProteinID:  XP_017894414 UniProt:  A0A452EUH0 LinkDB All DBs Position 23 AA seq 261 aa AA seqDB search MSGMVALQIPRGLWTAAVMVTLVVLSTPGAEGRDSPQDFLVQFKAQCYFTNGTERVRYVT RYIYNREEYVRFDSDWDKYRAVTPLGRPDAEYWNSQEDFLEQTRAEADTVCRHNYQAELI TSLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI RNGDWTFQILVMLEMTPQRGDVYTCRVEHPSLQSPIMVEWRAQSESAQSKMLSGVGGFVL GLIFLGLGLIIRHRSQKGLVR NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atgtctgggatggtggctctgcagatccccagaggcctttggacagcagctgtgatggtg accctggtggtgctgagcaccccaggggccgagggcagagactcgccacaggatttcctg gtccagtttaaggcccagtgttacttcaccaacgggacggagcgggtgcggtacgtgacc agatacatctacaaccgggaggagtacgtgcgcttcgacagcgactgggacaagtaccgg gcggtgacgccgctggggcggccggacgccgagtactggaacagccaggaggacttcctg gagcagacgcgggccgaggcggacacggtgtgcagacacaactaccaggcggagctcatc acctccttgcagcggcgagtggaacctacagtgaccatctccccgtccaggactgaggct ctaaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaag gttcggtggttccggaatgaccaggaggagacagctggagttgtgtccacacctcttatt aggaacggggactggaccttccagatcctggtgatgctggaaatgacccctcagcgagga gatgtctacacctgccgcgtggagcaccccagcctccagagccccatcatggtggagtgg cgggcgcagtctgaatctgcccagagcaagatgctgagtggtgttgggggcttcgtgctg gggctgatcttcctcgggctgggcctcattatccgtcacaggagccagaaggggctcgtg cgctga

Capra hircus (goat): 102186442 Help Entry 102186442         CDS       T02910                                  Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102186442  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102186442  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102186442    04612 Antigen processing and presentation     102186442    04658 Th1 and Th2 cell differentiation     102186442    04659 Th17 cell differentiation     102186442    04672 Intestinal immune network for IgA production     102186442  09160 Human Diseases   09163 Immune disease    05310 Asthma     102186442    05322 Systemic lupus erythematosus     102186442    05323 Rheumatoid arthritis     102186442    05320 Autoimmune thyroid disease     102186442    05321 Inflammatory bowel disease     102186442    05330 Allograft rejection     102186442    05332 Graft-versus-host disease     102186442   09166 Cardiovascular disease    05416 Viral myocarditis     102186442   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102186442   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102186442    05152 Tuberculosis     102186442   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102186442    05164 Influenza A     102186442    05168 Herpes simplex virus 1 infection     102186442    05169 Epstein-Barr virus infection     102186442   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102186442    05140 Leishmaniasis     102186442  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102186442 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102186442   Exosomal proteins of epithelial cells    102186442   Exosomal proteins of breast milk    102186442 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Psg1 ig Marek_A Motif Other DBs NCBI-GeneID:  102186442 NCBI-ProteinID:  XP_017894808 LinkDB All DBs Position 23 AA seq 260 aa AA seqDB search MVCLWYPPGSWTVILPVILMVLSPLLAWAGNTRTLFMVQGKSECHFSNGTQQVRFLDRYI YNREELVRFDSLVGEYRARTEMGRPAAERWNRWPDAPQRARAAGHDFCASNYEFFASRTV QRRVEPTVTVYPVKSRPLWHHNLLVCSVNGFYPGHIEVKWFQNGQEEEAGVVSTGLIPNG DWTFQIMVMLEIVPQGGEVYTCHVEHPSRMSPVTAEWRAQDESSKEKMLSGIGACVLGLL FLGMGLLFYIRRSPELEQRP NT seq 783 nt NT seq  +upstreamnt  +downstreamnt atggtgtgcctttggtaccccccaggctcctggacagtaattctgccagtgatactgatg gtgctgagccctctcctggcttgggctggaaacacccgaacactcttcatggtgcagggc aagtccgagtgtcacttctccaacggcacgcagcaggtgcgcttcctggacaggtacatc tacaaccgcgaggagctggtgcgcttcgacagcctcgtgggcgagtaccgggcgcggacc gagatggggcggccggcggccgagcgctggaaccgctggcccgacgccccgcagcgggcg cgcgccgccgggcacgacttctgcgccagcaactacgagttctttgcaagccgcacggtg cagaggagagttgagcctacggtgactgtgtatcctgtaaagagtcggcctctatggcac cacaacctcctggtctgctctgtgaatggtttctaccctggccacattgaagtcaagtgg ttccagaatggccaggaagaggaggccggggtggtctccacaggcctgatccctaatgga gactggactttccagatcatggtgatgcttgaaatagttcctcagggtggagaggtctac acctgccacgtggagcaccccagccggatgagccctgtaacagcagaatggagggcacag gacgaatcttcaaaagaaaagatgctgagtggaatcggggcctgtgttctgggtctgctc ttccttgggatggggctgctcttctacatcaggaggtctcctgagctggagcagagacca tga

Capra hircus (goat): 102186727 Help Entry 102186727         CDS       T02910                                  Definition (RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102186727  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102186727  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102186727    04612 Antigen processing and presentation     102186727    04658 Th1 and Th2 cell differentiation     102186727    04659 Th17 cell differentiation     102186727    04672 Intestinal immune network for IgA production     102186727  09160 Human Diseases   09163 Immune disease    05310 Asthma     102186727    05322 Systemic lupus erythematosus     102186727    05323 Rheumatoid arthritis     102186727    05320 Autoimmune thyroid disease     102186727    05321 Inflammatory bowel disease     102186727    05330 Allograft rejection     102186727    05332 Graft-versus-host disease     102186727   09166 Cardiovascular disease    05416 Viral myocarditis     102186727   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102186727   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102186727    05152 Tuberculosis     102186727   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102186727    05164 Influenza A     102186727    05168 Herpes simplex virus 1 infection     102186727    05169 Epstein-Barr virus infection     102186727   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102186727    05140 Leishmaniasis     102186727  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102186727 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102186727   Exosomal proteins of epithelial cells    102186727   Exosomal proteins of breast milk    102186727 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A Motif Other DBs NCBI-GeneID:  102186727 NCBI-ProteinID:  XP_005696261 LinkDB All DBs Position 23 AA seq 298 aa AA seqDB search MKKALILRALALAAMMSPCGGEDIVADHVGTYGTNVYQTYGASGQFTFEFDGDELFYVDL RKKETVWRLPEFNNITMFEIQSALRNIVMSKRNLDILMKNSNFTPATNDIPEVAVFPKSS VALGIPNTLICQVDNIFPPVINITWFYNGQFVAEGVAETTFYPKSDHSFLKFSYLTFLPA SEDFYDCRVEHWGLEEPLVKHWEPKIPTPTSELTETVVCALGLPMGLMGIVAGTVLILRV RCSGAASRRRRAMSHGLKDGKHREHRTISLMLLGVSGDQSLQEKKGVVQTPVPHLDLD NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atgaagaaagctctgattctgagggctctcgctctggccgccatgatgagcccctgtgga ggtgaagacatcgtggcggaccatgtgggcacttatggcacaaatgtctaccagacgtac ggcgcctctggccagttcacgtttgaatttgatggagacgagctcttctacgtggacctg aggaaaaaagagactgtctggaggctgcccgagtttaacaatatcaccatgtttgaaatt caaagtgccctgagaaacattgttatgtcaaaaagaaatttggacatcttgatgaaaaat tccaactttacacctgccaccaacgacatccctgaagtggctgtgtttcccaaatcctct gtggccctggggattcccaacaccctcatctgtcaagtggacaacatctttcctcctgtg atcaacatcacttggttttacaatggacaatttgttgcagaaggtgtcgctgagaccacc ttctaccccaagagtgaccactccttcctcaagttcagttacctcacctttcttcccgcc agtgaagacttctatgactgcagagtggagcactggggcctggaagagcccctcgtcaag cactgggagcccaagattccaacccctacatcagagctgacagagactgtggtctgtgcc ctggggttgcccatgggcctcatgggcatcgtggcgggcactgtcctcatcctccgagtc cggtgctcaggtgctgcctccagacgtcgaagggccatgagtcatggcctgaaagatggg aagcatcgggagcacaggaccatcagcctcatgctacttggtgtttcaggtgatcagtct ttacaagaaaagaaaggcgtggttcagactccagttccccatcttgaccttgactga

Capra hircus (goat): 102187356 Help Entry 102187356         CDS       T02910                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO beta chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102187356  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102187356  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102187356    04612 Antigen processing and presentation     102187356    04658 Th1 and Th2 cell differentiation     102187356    04659 Th17 cell differentiation     102187356    04672 Intestinal immune network for IgA production     102187356  09160 Human Diseases   09163 Immune disease    05310 Asthma     102187356    05322 Systemic lupus erythematosus     102187356    05323 Rheumatoid arthritis     102187356    05320 Autoimmune thyroid disease     102187356    05321 Inflammatory bowel disease     102187356    05330 Allograft rejection     102187356    05332 Graft-versus-host disease     102187356   09166 Cardiovascular disease    05416 Viral myocarditis     102187356   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102187356   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102187356    05152 Tuberculosis     102187356   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102187356    05164 Influenza A     102187356    05168 Herpes simplex virus 1 infection     102187356    05169 Epstein-Barr virus infection     102187356   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102187356    05140 Leishmaniasis     102187356  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102187356 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102187356   Exosomal proteins of epithelial cells    102187356   Exosomal proteins of breast milk    102187356 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig C2-set_2 Motif Other DBs NCBI-GeneID:  102187356 NCBI-ProteinID:  XP_005696263 LinkDB All DBs Position 23 AA seq 285 aa AA seqDB search MEIFLSCLLSSRMSPIWVPWVVAFSSTVLRLDASMTQGRDSPEDFVTQAKADCYFTNGTE KVRFVVRFIFNLEEYARFDSDLGMFVALTELGKPDAELWNNRPDILARSRASVDMLCRRN YNLGAPFTVGRRVQPEVTVYPEKTPALQHRNLLLCLVTGFYPGDIKVTWFRNGQEQREGV MSTGLIRNGDWTFQTTVMLPMTPELGEVYTCLVDHPSLPSPVSVEWRAQSEYSWRKMLSG AAAFLVGLVFFLVGIAIHIRARKGHVETPLLGNEVPRAVLPPQPH NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atggagattttcctgtcttgtttgctttcttccagaatgagtcctatttgggttccctgg gtggtggccttctcatccacggttctcaggctggatgcttctatgactcaaggcagagat tctccagaagattttgtgacccaggcaaaggctgactgttacttcaccaatgggacagaa aaggtgcggtttgtggtcagattcatcttcaacctggaggagtatgcacgtttcgacagc gacttgggaatgtttgtggccttgacggagctgggcaagcccgatgctgagctgtggaac aatcggccagatatactggcgaggagtagagcctctgtggacatgctttgcagacgcaac tacaatctgggagcacccttcaccgtggggaggagagtgcaaccagaggtgacagtgtat ccggagaagaccccagccctgcagcaccgcaatctgctgctttgcttggtgacaggtttc tacccaggggacatcaaggtcacctggttccggaatgggcaggaacaaagagagggggtc atgtccaccggcctcatcaggaatggagactggacctttcagacgacggtgatgctgccc atgacgcctgagcttggagaggtctacacctgccttgttgaccatcccagcttgccgagc cctgtttctgtggagtggagagctcagtctgaatattcttggagaaagatgctgagtgga gctgcagccttcctggtcgggctagtcttctttctggtgggaattgccatccacatcagg gcccggaaaggacatgtggagactccgttgcttggcaatgaggtcccaagagcagtgctt ccaccacagccgcactag

Capra hircus (goat): 102187998 Help Entry 102187998         CDS       T02910                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM beta chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102187998  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102187998  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102187998    04612 Antigen processing and presentation     102187998    04658 Th1 and Th2 cell differentiation     102187998    04659 Th17 cell differentiation     102187998    04672 Intestinal immune network for IgA production     102187998  09160 Human Diseases   09163 Immune disease    05310 Asthma     102187998    05322 Systemic lupus erythematosus     102187998    05323 Rheumatoid arthritis     102187998    05320 Autoimmune thyroid disease     102187998    05321 Inflammatory bowel disease     102187998    05330 Allograft rejection     102187998    05332 Graft-versus-host disease     102187998   09166 Cardiovascular disease    05416 Viral myocarditis     102187998   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102187998   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102187998    05152 Tuberculosis     102187998   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102187998    05164 Influenza A     102187998    05168 Herpes simplex virus 1 infection     102187998    05169 Epstein-Barr virus infection     102187998   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102187998    05140 Leishmaniasis     102187998  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102187998 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102187998   Exosomal proteins of epithelial cells    102187998   Exosomal proteins of breast milk    102187998 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set MHC_II_beta Ig_3 Ig_2 ig C2-set_2 Motif Other DBs NCBI-GeneID:  102187998 NCBI-ProteinID:  XP_005696266 UniProt:  A0A452G7S1 LinkDB All DBs Position 23 AA seq 262 aa AA seqDB search MTVLLPLLLGLSLGCTGAGGFVAHVESTCLLDDDGSPKEFTYCVSFNKDLLTCWDPLQAS MVPREFGVLNGLAKYLSDSLNSDDVLIQRLSSGLQDCAVHTQPFWSSLTHRTRPPTVQVA RTTPFNTRESVMLACYVWGFYPADVAITWRRNGQEVLPHGTAWRVIQPNGDWTYQTVSHL ATTPSFGDTYTCVVEHIGAPELILQDWTPGLLPVQAVKVSLSLVTLVLGFIVFVFGLRSW QRAASSGYIFLPGSTYPEGHHD NT seq 789 nt NT seq  +upstreamnt  +downstreamnt atgactgtcctcttgccgctgctgctgggcctcagcctgggctgcaccggagcaggtggc tttgtggcacacgtggaaagcacctgtctgttggacgatgatgggagtccaaaagagttc acgtattgcgtctccttcaacaaggacttgctgacctgctgggatcccctgcaggccagt atggttcctcgtgaatttggggtgctgaacggcttggccaagtacctctcagattccctc aacagtgacgatgtcctgatccagcgcttgtccagtggtctgcaggactgtgccgtgcac acccagcccttctggagctctctgacccacaggacacgcccgccgaccgtgcaggtagcc agaaccactccttttaacacgagggagtctgtgatgctggcctgctacgtgtggggcttc tacccagcggacgtggccatcacgtggaggaggaacgggcaggaggtcctcccacacggc acagcctggagggtcatccagcccaatggagactggacgtaccagaccgtctcccacctg gccacaaccccctcttttggggacacctacacctgtgtggtcgagcacattggggctcct gaactcatccttcaggactggactcctgggctgttgcctgtgcaggcggtgaaggtttcc ttgtctctggtaacgctggtcctgggcttcatcgtcttcgtttttggtctgcgcagttgg cagagagccgcctcctccggctacattttcctcccggggtccacttatccagaaggtcat cacgattga

Capra hircus (goat): 102188267 Help Entry 102188267         CDS       T02910                                  Definition (RefSeq) HLA class II histocompatibility antigen, DM alpha chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102188267  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102188267  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102188267    04612 Antigen processing and presentation     102188267    04658 Th1 and Th2 cell differentiation     102188267    04659 Th17 cell differentiation     102188267    04672 Intestinal immune network for IgA production     102188267  09160 Human Diseases   09163 Immune disease    05310 Asthma     102188267    05322 Systemic lupus erythematosus     102188267    05323 Rheumatoid arthritis     102188267    05320 Autoimmune thyroid disease     102188267    05321 Inflammatory bowel disease     102188267    05330 Allograft rejection     102188267    05332 Graft-versus-host disease     102188267   09166 Cardiovascular disease    05416 Viral myocarditis     102188267   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102188267   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102188267    05152 Tuberculosis     102188267   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102188267    05164 Influenza A     102188267    05168 Herpes simplex virus 1 infection     102188267    05169 Epstein-Barr virus infection     102188267   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102188267    05140 Leishmaniasis     102188267  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102188267 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102188267   Exosomal proteins of epithelial cells    102188267   Exosomal proteins of breast milk    102188267 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set FAST_1 SKG6 Ig_2 Motif Other DBs NCBI-GeneID:  102188267 NCBI-ProteinID:  XP_005696267 LinkDB All DBs Position 23 AA seq 261 aa AA seqDB search MDRGPSQETALLRLLSFLWLLPLSWTAPEAPAPGWTDDLQNHTLLHTVYCQDWSPSVGLS EAYDGDQLFSFDFSQNIRVPRLPEFADWAHQHGDTSNIMFDKGFCRTMIEEIGPQLEGKI PVSRGFPIVQVFTLKPLEFGKPNTLVCFISNLFPPTLTVEWQHQSAPVEGVGPTFVSAVD GLTFQAFSYLNFTPESSDLFSCIVTHEIDGYTAIAFWVPQNALPSDLLENVLCGVAFGLG VLGITVGVVLIIYSRKPCSGG NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atggaccgtgggccgagccaggaaactgcgctgctacggctgctctcctttctgtggctg ctgcccctgtcctggaccgcccctgaagctcctgctccagggtggacggatgacctgcaa aaccacacgctcctgcacacagtgtattgccaggactggagccccagtgtggggctctct gaggcctacgacggggaccagcttttctccttcgacttttcccagaacatccgagtgcct cgcttgcctgaatttgctgactgggctcaccagcacggagatacctccaacattatgttt gacaaaggtttttgccggaccatgatcgaggaaattggcccacaacttgaagggaagatc cctgtgtctagagggttccccattgttcaggtgttcacactgaagcccctggagtttggc aagcccaacacgctggtctgtttcatcagtaacctctttccacccacactgaccgtggag tggcagcatcagtcggcgcccgtggaaggagtcgggcccacttttgtctctgcggttgat ggactcaccttccaggccttttcctacctaaacttcacaccagaatcctctgatcttttt tcttgcatcgtgactcatgagatcgatggctacacagcaatcgctttttgggtgccccag aacgcgctgccctctgatcttctggagaatgtgctgtgcggcgtggcttttggcctgggt gtgctgggcatcactgttggcgtggtccttatcatctactcccggaagccgtgctcaggg ggctga

Capra hircus (goat): 102188986 Help Entry 102188986         CDS       T02910                                  Definition (RefSeq) HLA class II histocompatibility antigen, DO alpha chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102188986  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102188986  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102188986    04612 Antigen processing and presentation     102188986    04658 Th1 and Th2 cell differentiation     102188986    04659 Th17 cell differentiation     102188986    04672 Intestinal immune network for IgA production     102188986  09160 Human Diseases   09163 Immune disease    05310 Asthma     102188986    05322 Systemic lupus erythematosus     102188986    05323 Rheumatoid arthritis     102188986    05320 Autoimmune thyroid disease     102188986    05321 Inflammatory bowel disease     102188986    05330 Allograft rejection     102188986    05332 Graft-versus-host disease     102188986   09166 Cardiovascular disease    05416 Viral myocarditis     102188986   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102188986   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102188986    05152 Tuberculosis     102188986   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102188986    05164 Influenza A     102188986    05168 Herpes simplex virus 1 infection     102188986    05169 Epstein-Barr virus infection     102188986   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102188986    05140 Leishmaniasis     102188986  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102188986 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102188986   Exosomal proteins of epithelial cells    102188986   Exosomal proteins of breast milk    102188986 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  102188986 NCBI-ProteinID:  XP_013829269 LinkDB All DBs Position 23 AA seq 250 aa AA seqDB search MVLRGRLVLGLHTLMTLLSPQEVGAIKADHMGSYGPAFYQSYDGAGQFTYDFDGEQLFSV DLKKREAVWRLPEFGNFAYFDPQNGLVSIAMIKAHLEVLVERSNGTRAPNVPPRVAVLPK SRVQLGEPNVLICIVDNIFPPVINVTWLRNGQPITQGVTQTSFYAQPDHSFRKFHYLTFV PLADDFYDCKVEHWGLDQPLFQHWEPQVPTVLPDTTGTLVCALGLILGLGGFLGGITLII TGTCLSSAPR NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atggtcctcagggggaggctggtcctgggactgcacaccctgatgaccctcctgagcccc caggaagttggggccatcaaggctgaccacatgggttcctatggaccagccttctaccag tcctatgacggtgcaggtcagttcacctatgattttgatggagaacagctgttctctgtg gacctgaagaagagggaggctgtgtggcgtctgcctgaatttggcaacttcgcctacttt gacccgcagaacgggctggtcagtatcgcgatgatcaaagcgcatctggaggtcttggtg gagcgctccaacggcaccagagcccccaacgtgccccccagagtggctgtgctgcccaag tctcgggtgcagctgggcgagcccaacgtcctcatctgcatcgtggacaacatcttcccc ccggtcatcaacgtcacctggctgcgcaacggccagcccatcacccagggcgtgacccag accagcttctacgcccagcctgaccactcgttccggaagttccactacttgacctttgtg cccttggcagacgacttctatgactgcaaggtggagcactggggcctggaccagccactc tttcagcactgggagccccaggtgcccaccgtgctgcctgacaccacagggactctggtc tgtgcccttggcctgatcctcggcctggggggcttcctcgggggcatcaccctcatcatc acaggcacgtgcctgtccagtgcccccaggtga

Capra hircus (goat): 102189356 Help Entry 102189356         CDS       T02910                                  Gene name DRA Definition (RefSeq) HLA class II histocompatibility antigen, DR alpha chain   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102189356 (DRA)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102189356 (DRA)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102189356 (DRA)    04612 Antigen processing and presentation     102189356 (DRA)    04658 Th1 and Th2 cell differentiation     102189356 (DRA)    04659 Th17 cell differentiation     102189356 (DRA)    04672 Intestinal immune network for IgA production     102189356 (DRA)  09160 Human Diseases   09163 Immune disease    05310 Asthma     102189356 (DRA)    05322 Systemic lupus erythematosus     102189356 (DRA)    05323 Rheumatoid arthritis     102189356 (DRA)    05320 Autoimmune thyroid disease     102189356 (DRA)    05321 Inflammatory bowel disease     102189356 (DRA)    05330 Allograft rejection     102189356 (DRA)    05332 Graft-versus-host disease     102189356 (DRA)   09166 Cardiovascular disease    05416 Viral myocarditis     102189356 (DRA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102189356 (DRA)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102189356 (DRA)    05152 Tuberculosis     102189356 (DRA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102189356 (DRA)    05164 Influenza A     102189356 (DRA)    05168 Herpes simplex virus 1 infection     102189356 (DRA)    05169 Epstein-Barr virus infection     102189356 (DRA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102189356 (DRA)    05140 Leishmaniasis     102189356 (DRA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102189356 (DRA) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102189356 (DRA)   Exosomal proteins of epithelial cells    102189356 (DRA)   Exosomal proteins of breast milk    102189356 (DRA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Marek_A Motif Other DBs NCBI-GeneID:  102189356 NCBI-ProteinID:  NP_001301117 UniProt:  O19810 LinkDB All DBs Position 23 AA seq 253 aa AA seqDB search MAITRVPILGLFITVLISLQELWAIKEDHVIIQAEFYLNPEQSAEFMFDFDGDEIFHVDM QKKETVWRLPEFGRFASFEAQGALANMAVMKANLDIMIKRSNNTPNTNVPPEVTLLPNKP VELGEPNTLICFIDKFSPPVISVTWLRNGIPVTDGVSQTVFLPRDDHLFRKFHYLPFLPT TEDVYDCKVEHWGLNEPLLKHWEYEAPAPLPETTENAVCALGLIVALVGIIAGTIFIIKG VRKANTVERRGPL NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atggccataaccagggtcccaatattaggacttttcatcactgtcctgatcagcctacag gaattgtgggctattaaagaggaccatgtgatcatccaggctgagttctatctgaaccct gagcaatcagccgagtttatgtttgactttgatggtgatgagattttccacgtggatatg cagaagaaggagacagtgtggcggcttccagaatttggacgttttgccagctttgaggct cagggtgccctggccaatatggctgtgatgaaagccaacctggacatcatgataaagcgc tccaacaacaccccgaacaccaatgttcctccagaagtgactctgctcccaaacaagcct gtggaactgggagagcccaacacactcatctgcttcattgacaagttctcaccacccgtg atcagtgtcacgtggcttcgaaatggcatacctgtcactgacggagtgtcacagacggtc ttcctgcccagggatgaccaccttttccgcaagttccactacctccccttcctgcccaca acagaggatgtctatgactgcaaggtggagcactggggtctgaacgagcctcttctcaag cactgggagtatgaagctccagcccctctcccagagacgacagagaatgcagtgtgtgcc ctgggcctgattgtggctctggtgggcatcattgcagggaccatcttcatcatcaagggc gtgcgcaaagccaacactgttgaacgccgagggcctctgtga

Capra hircus (goat): 102190745 Help Entry 102190745         CDS       T02910                                  Definition (RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102190745  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102190745  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102190745    04612 Antigen processing and presentation     102190745    04658 Th1 and Th2 cell differentiation     102190745    04659 Th17 cell differentiation     102190745    04672 Intestinal immune network for IgA production     102190745  09160 Human Diseases   09163 Immune disease    05310 Asthma     102190745    05322 Systemic lupus erythematosus     102190745    05323 Rheumatoid arthritis     102190745    05320 Autoimmune thyroid disease     102190745    05321 Inflammatory bowel disease     102190745    05330 Allograft rejection     102190745    05332 Graft-versus-host disease     102190745   09166 Cardiovascular disease    05416 Viral myocarditis     102190745   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102190745   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102190745    05152 Tuberculosis     102190745   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102190745    05164 Influenza A     102190745    05168 Herpes simplex virus 1 infection     102190745    05169 Epstein-Barr virus infection     102190745   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102190745    05140 Leishmaniasis     102190745  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102190745 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102190745   Exosomal proteins of epithelial cells    102190745   Exosomal proteins of breast milk    102190745 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig MHC_I Motif Other DBs NCBI-GeneID:  102190745 NCBI-ProteinID:  XP_017894576 LinkDB All DBs Position 23 AA seq 255 aa AA seqDB search MAALAVLLMVLSPPFSWARETQSLFMHQFKGECRFSNGLERMRFFARYIYNTKEDVHFDS DVGEFTALTELGRPDAEYWNQQKDFMEQMRAKVDTVCRSNYQGIGSFLRQRRVEPAVTVY PAKTQPLQHHSLLVCSVNGFYPGHIEVRWFRNGHEEEAGVISTGLIQNGDWTFQTVVMLE TVPQGGEVYTCQVEHPSRTSPLTVEWRAQSDSAQRKLISGVGGFVLGLLFLGVGLFIHFR SKKGHPALQPIGPLS NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atggcagctttggcagtgctactgatggtgctcagccctcccttctcttgggccagggaa acccaatcccttttcatgcatcagtttaagggtgagtgtcgtttctccaacgggttggag cggatgcggttctttgccagatacatctacaacacgaaggaggatgtgcacttcgacagc gatgtgggggagttcacggccctgacggagctggggaggccggacgccgagtactggaac cagcaaaaggacttcatggagcagatgcgggccaaggtggacacggtgtgcagatccaac taccagggcattggtagcttcctgaggcagcgccgagtggagcctgcagtgactgtgtat cctgcaaagacccagcccctgcagcaccacagcctcctggtctgctctgtgaatggattc tacccaggccacattgaagtcaggtggttccggaacggccacgaagaggaggctggggtg atctccacaggcctgatccagaatggagactggaccttccagaccgtggtgatgcttgaa acagttcctcagggtggagaggtctacacctgccaagtggagcaccccagccggacgagc cctctcacagtggaatggagagcacagtctgactctgctcagaggaagctgataagtgga gttggaggctttgttctgggtctgctcttccttggtgtggggctgttcatccatttcagg agtaagaaaggacaccctgcacttcagcctataggacccctgagctga

Capra hircus (goat): 106503481 Help Entry 106503481         CDS       T02910                                  Definition (RefSeq) rano class II histocompatibility antigen, A beta chain-like   KO K06752   MHC class II antigen Organism chx  Capra hircus (goat) Pathway chx04145   Phagosome chx04514   Cell adhesion molecules chx04612   Antigen processing and presentation chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04672   Intestinal immune network for IgA production chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05145   Toxoplasmosis chx05150   Staphylococcus aureus infection chx05152   Tuberculosis chx05164   Influenza A chx05166   Human T-cell leukemia virus 1 infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     106503481  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106503481  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106503481    04612 Antigen processing and presentation     106503481    04658 Th1 and Th2 cell differentiation     106503481    04659 Th17 cell differentiation     106503481    04672 Intestinal immune network for IgA production     106503481  09160 Human Diseases   09163 Immune disease    05310 Asthma     106503481    05322 Systemic lupus erythematosus     106503481    05323 Rheumatoid arthritis     106503481    05320 Autoimmune thyroid disease     106503481    05321 Inflammatory bowel disease     106503481    05330 Allograft rejection     106503481    05332 Graft-versus-host disease     106503481   09166 Cardiovascular disease    05416 Viral myocarditis     106503481   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     106503481   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     106503481    05152 Tuberculosis     106503481   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106503481    05164 Influenza A     106503481    05168 Herpes simplex virus 1 infection     106503481    05169 Epstein-Barr virus infection     106503481   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106503481    05140 Leishmaniasis     106503481  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     106503481 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106503481   Exosomal proteins of epithelial cells    106503481   Exosomal proteins of breast milk    106503481 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MHC_II_beta C1-set MHC_I NHase_alpha MtrF Motif Other DBs NCBI-GeneID:  106503481 NCBI-ProteinID:  XP_017894806 UniProt:  A0A452EF69 LinkDB All DBs Position 23 AA seq 274 aa AA seqDB search MRVTIPRNPGTVAGMVMAVFLVLRIPEAHCREAPKNFVYQFKGMCYFTNGTEHVRLVARQ IYNKEEILHFDSDLGEFVAVTELGRVCAEIWNTQKDLLAEFRAYVETLCRRNYKETVGST VQRRVEPTVTVSPASTEAPNLHNLLVCSVTNFYPRQVKVKWFRNQQEQTAGVGFTPLTQN GDWTYQIHMMLETIPQLGDIYVCHVDHPSLQSPITVEWRAQSESAQSKMRSGIGGFVLGL IFLGVGLFVHFWDKRGKAPWEKKGKTGAGLKSLC NT seq 825 nt NT seq  +upstreamnt  +downstreamnt atgagggtgaccatccccaggaaccctgggactgtggctggaatggtgatggctgtgttt ctggtgctgaggatccccgaggctcactgcagagaggctccgaagaatttcgtgtaccag tttaaaggcatgtgctacttcaccaatgggacggaacacgtgaggcttgtggccagacag atctacaacaaggaagagatcctgcactttgacagcgacctgggcgagtttgtggctgtt acagagctgggccgggtgtgtgctgagatctggaacacccagaaggacctcctggcggag tttcgggcctacgtggagacgctgtgtagacgcaactacaaggagacggtcggctccact gtccagcggagagtggagcctacagtgacggtctctccagccagtacagaggccccgaac ctccataatctgctggtctgttcagtgacaaatttctatcctcgccaagttaaagtcaaa tggttccggaatcaacaggagcagacagctggagttgggttcacacctcttactcagaat ggggactggacctaccagattcacatgatgctagagacaataccacagcttggagacatc tatgtttgccacgtggaccaccccagcctccagagccccatcacagtagaatggcgggca cagtctgaatctgcccagagcaagatgcggagtggaattggaggttttgtgctggggctg atcttccttggtgtgggcctttttgtccacttttgggataagagaggtaaggcgccttgg gagaaaaaggggaagacaggtgctgggctgaaaagcctctgttga

DBGET integrated database retrieval system