KEGG   Capra hircus (goat): 100860814
Entry
100860814         CDS       T02910                                 

Gene name
IL4, BSF-1, IL-4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04630  JAK-STAT signaling pathway
chx04640  Hematopoietic cell lineage
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04672  Intestinal immune network for IgA production
chx05140  Leishmaniasis
chx05200  Pathways in cancer
chx05310  Asthma
chx05320  Autoimmune thyroid disease
chx05321  Inflammatory bowel disease
chx05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100860814 (IL4)
   04151 PI3K-Akt signaling pathway
    100860814 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860814 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100860814 (IL4)
   04660 T cell receptor signaling pathway
    100860814 (IL4)
   04658 Th1 and Th2 cell differentiation
    100860814 (IL4)
   04659 Th17 cell differentiation
    100860814 (IL4)
   04657 IL-17 signaling pathway
    100860814 (IL4)
   04664 Fc epsilon RI signaling pathway
    100860814 (IL4)
   04672 Intestinal immune network for IgA production
    100860814 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860814 (IL4)
  09163 Immune disease
   05310 Asthma
    100860814 (IL4)
   05320 Autoimmune thyroid disease
    100860814 (IL4)
   05321 Inflammatory bowel disease
    100860814 (IL4)
   05330 Allograft rejection
    100860814 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100860814 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860814 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100860814 (IL4)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interleukins
   100860814 (IL4)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Haparin
  Cytokines
   100860814 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100860814
NCBI-ProteinID: NP_001272610
UniProt: P79155
LinkDB
Position
7
AA seq 135 aa
MGLTSQLIPALVCLLVCTSHFVHGHKCDITLEEIIKMLNILTSQKNSCMELPVADVFAAP
KNATEKETFCRAGIELRRIYRNHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgattccagcgctggtctgcttactggtatgtaccagccac
ttcgtccatggacacaagtgtgacattaccttagaagagatcatcaaaatgctgaacatc
ctcacatcgcagaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaatgcaactgagaaggaaaccttctgcagggctggaattgagcttaggcgtatctac
aggaaccacatgtgcttgaacaaattcctgggcggacttgacaggaatctcagcagcttg
gcaagcaagacctgttctgtgaatgaagccaagacaagtacaagtacgctgagagacctc
ttggaaaggctaaagactattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system