KEGG   Capra hircus (goat): 100860815
Entry
100860815         CDS       T02910                                 

Gene name
IFNG, IFN-gamma
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
chx  Capra hircus (goat)
Pathway
chx03050  Proteasome
chx04060  Cytokine-cytokine receptor interaction
chx04066  HIF-1 signaling pathway
chx04217  Necroptosis
chx04350  TGF-beta signaling pathway
chx04380  Osteoclast differentiation
chx04612  Antigen processing and presentation
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04940  Type I diabetes mellitus
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05144  Malaria
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05200  Pathways in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100860815 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100860815 (IFNG)
   04630 JAK-STAT signaling pathway
    100860815 (IFNG)
   04066 HIF-1 signaling pathway
    100860815 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860815 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100860815 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100860815 (IFNG)
   04612 Antigen processing and presentation
    100860815 (IFNG)
   04660 T cell receptor signaling pathway
    100860815 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100860815 (IFNG)
   04659 Th17 cell differentiation
    100860815 (IFNG)
   04657 IL-17 signaling pathway
    100860815 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100860815 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860815 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100860815 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100860815 (IFNG)
   05323 Rheumatoid arthritis
    100860815 (IFNG)
   05321 Inflammatory bowel disease
    100860815 (IFNG)
   05330 Allograft rejection
    100860815 (IFNG)
   05332 Graft-versus-host disease
    100860815 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100860815 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100860815 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100860815 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100860815 (IFNG)
   05164 Influenza A
    100860815 (IFNG)
   05168 Herpes simplex virus 1 infection
    100860815 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100860815 (IFNG)
   05144 Malaria
    100860815 (IFNG)
   05145 Toxoplasmosis
    100860815 (IFNG)
   05140 Leishmaniasis
    100860815 (IFNG)
   05142 Chagas disease
    100860815 (IFNG)
   05143 African trypanosomiasis
    100860815 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:chx03051]
    100860815 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860815 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100860815 (IFNG)
Proteasome [BR:chx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100860815 (IFNG)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   100860815 (IFNG)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Cytokines
   100860815 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DnaGprimase_HBD PRANC Cep57_MT_bd
Other DBs
NCBI-GeneID: 100860815
NCBI-ProteinID: NP_001272611
UniProt: P79154
LinkDB
Position
5
AA seq 166 aa
MKYTSSFLALLLSVLLGFSGSYGQGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWK
EESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatacacaagctccttcttagctttactgctaagtgtgcttttgggtttttctggt
tcttatggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca
agtaacccagatgtagctaagggtgggcctcttttctcagaaattttgaagaattggaaa
gaggagagtgacaaaaagattattcagagccaaattgtctccttctacttcaaactcttt
gaaaatctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaacggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaggtgatg
aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa

DBGET integrated database retrieval system