Capra hircus (goat): 100860815 Help Entry 100860815         CDS       T02910                                  Gene name IFNG, IFN-gamma Definition (RefSeq) interferon gamma   KO K04687   interferon gamma Organism chx  Capra hircus (goat) Pathway chx03050   Proteasome chx04060   Cytokine-cytokine receptor interaction chx04066   HIF-1 signaling pathway chx04217   Necroptosis chx04350   TGF-beta signaling pathway chx04380   Osteoclast differentiation chx04612   Antigen processing and presentation chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04940   Type I diabetes mellitus chx05140   Leishmaniasis chx05142   Chagas disease chx05143   African trypanosomiasis chx05144   Malaria chx05145   Toxoplasmosis chx05146   Amoebiasis chx05152   Tuberculosis chx05160   Hepatitis C chx05164   Influenza A chx05168   Herpes simplex virus 1 infection chx05200   Pathways in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05321   Inflammatory bowel disease chx05322   Systemic lupus erythematosus chx05323   Rheumatoid arthritis chx05330   Allograft rejection chx05332   Graft-versus-host disease chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100860815 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100860815 (IFNG)    04630 JAK-STAT signaling pathway     100860815 (IFNG)    04066 HIF-1 signaling pathway     100860815 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100860815 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100860815 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100860815 (IFNG)    04612 Antigen processing and presentation     100860815 (IFNG)    04660 T cell receptor signaling pathway     100860815 (IFNG)    04658 Th1 and Th2 cell differentiation     100860815 (IFNG)    04659 Th17 cell differentiation     100860815 (IFNG)    04657 IL-17 signaling pathway     100860815 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     100860815 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100860815 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100860815 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     100860815 (IFNG)    05323 Rheumatoid arthritis     100860815 (IFNG)    05321 Inflammatory bowel disease     100860815 (IFNG)    05330 Allograft rejection     100860815 (IFNG)    05332 Graft-versus-host disease     100860815 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100860815 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100860815 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     100860815 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     100860815 (IFNG)    05164 Influenza A     100860815 (IFNG)    05168 Herpes simplex virus 1 infection     100860815 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     100860815 (IFNG)    05144 Malaria     100860815 (IFNG)    05145 Toxoplasmosis     100860815 (IFNG)    05140 Leishmaniasis     100860815 (IFNG)    05142 Chagas disease     100860815 (IFNG)    05143 African trypanosomiasis     100860815 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:chx03051]     100860815 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     100860815 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     100860815 (IFNG) Proteasome [BR:chx03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     100860815 (IFNG) Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    100860815 (IFNG) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Cytokines    100860815 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 DnaGprimase_HBD PRANC Cep57_MT_bd Motif Other DBs NCBI-GeneID:  100860815 NCBI-ProteinID:  NP_001272611 UniProt:  P79154 LinkDB All DBs Position 5 AA seq 166 aa AA seqDB search MKYTSSFLALLLSVLLGFSGSYGQGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWK EESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatacacaagctccttcttagctttactgctaagtgtgcttttgggtttttctggt tcttatggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca agtaacccagatgtagctaagggtgggcctcttttctcagaaattttgaagaattggaaa gaggagagtgacaaaaagattattcagagccaaattgtctccttctacttcaaactcttt gaaaatctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg tttcagaagttcttgaacggcagctctgagaaactggaggacttcaaaaagctgattcaa attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaggtgatg aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga ggccggagagcatcaatgtaa

DBGET integrated database retrieval system