KEGG   Capra hircus (goat): 100860845
Entry
100860845         CDS       T02910                                 

Gene name
IL12B, IL-12, IL-12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04620  Toll-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04940  Type I diabetes mellitus
chx05133  Pertussis
chx05134  Legionellosis
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05321  Inflammatory bowel disease
chx05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100860845 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860845 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100860845 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100860845 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100860845 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100860845 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860845 (IL12B)
   05205 Proteoglycans in cancer
    100860845 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100860845 (IL12B)
   05330 Allograft rejection
    100860845 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100860845 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100860845 (IL12B)
   05134 Legionellosis
    100860845 (IL12B)
   05152 Tuberculosis
    100860845 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100860845 (IL12B)
   05164 Influenza A
    100860845 (IL12B)
   05162 Measles
    100860845 (IL12B)
   05168 Herpes simplex virus 1 infection
    100860845 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100860845 (IL12B)
   05145 Toxoplasmosis
    100860845 (IL12B)
   05140 Leishmaniasis
    100860845 (IL12B)
   05142 Chagas disease
    100860845 (IL12B)
   05143 African trypanosomiasis
    100860845 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860845 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100860845 (IL12B)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interleukins
   100860845 (IL12B)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Cytokines
   100860845 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 fn3 Ig_2 I-set
Other DBs
NCBI-GeneID: 100860845
NCBI-ProteinID: NP_001272629
UniProt: P68221 Q6E218
LinkDB
Position
7
AA seq 327 aa
MHPQQLVVSWFSLVLLASPIVAIWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQ
KEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKV
SMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCH
KDANIRVQARDRYYSSFWSEWASVSCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatctcccatc
gtggccatatgggaactggagaaaaatgtttatgttgtagaattggattggtatcctaat
gctcctggagaaacagtggtcctcacgtgtgacactcctgaagaagacggcatcacctgg
acctcagaccagagcagtgaggtcctgggctctggcaaaaccttgaccattcaagtcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggttctgagtcgttca
ctcctcctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag
aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc
acctgctcgtggctgacagcaatcagtactaatctgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgcggagcagcgtcactctcagcagagaaggtc
agcatggaccacagggagtataacaagtacacagtggagtgtcaggagggcagtgcctgc
ccggccgccgaggagagcctgcccattgaggtcgtgatggaagctgtgcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcaactgagaccactaaagaattctcggcaggtggaggtcagctgggagtaccct
gacacgtggagcaccccacattcctacttctccctgacgttttgtgttcaggtccaggga
aagaacaagagagaaaagaaactcttcacggaccaaacctcagccaaagtcacatgccac
aaggatgccaacatccgtgtgcaagcccgggaccgctactacagctcattctggagtgaa
tgggcatctgtgtcctgcagttag

KEGG   Capra hircus (goat): 100861293
Entry
100861293         CDS       T02910                                 

Gene name
IL12A, IL-12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04620  Toll-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04940  Type I diabetes mellitus
chx05133  Pertussis
chx05134  Legionellosis
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05144  Malaria
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05321  Inflammatory bowel disease
chx05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100861293 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100861293 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100861293 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100861293 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100861293 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100861293 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861293 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100861293 (IL12A)
   05330 Allograft rejection
    100861293 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100861293 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100861293 (IL12A)
   05134 Legionellosis
    100861293 (IL12A)
   05152 Tuberculosis
    100861293 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100861293 (IL12A)
   05164 Influenza A
    100861293 (IL12A)
   05162 Measles
    100861293 (IL12A)
   05168 Herpes simplex virus 1 infection
    100861293 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100861293 (IL12A)
   05144 Malaria
    100861293 (IL12A)
   05145 Toxoplasmosis
    100861293 (IL12A)
   05140 Leishmaniasis
    100861293 (IL12A)
   05142 Chagas disease
    100861293 (IL12A)
   05143 African trypanosomiasis
    100861293 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100861293 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100861293 (IL12A)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interleukins
   100861293 (IL12A)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Cytokines
   100861293 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100861293
NCBI-ProteinID: NP_001272567
UniProt: O02814
LinkDB
Position
1
AA seq 221 aa
MCPLRSLLLISTLVLLHHLPHLSLGRSLPITTAGPGRSCLDYSQNLLRAVSNTLQKARQT
LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSLITNGHCLASGKTSF
MTTLCLRSIYKDLKMYHMEFQAINAKLLMDPKRQVSLDQNMLAAIAELMQALNFDSETVP
QKPSLEELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtgcccgcttcgaagcctcctcctcatatccaccctggttctcctccaccacctgccc
cacctcagtttgggcaggagcctgcccatcaccactgcaggcccaggaaggagttgcctt
gactactcccaaaacctgctgagggccgtcagcaacacgctgcagaaggccagacaaacc
ctagaattttactcctgcacttctgaggagattgatcatgaagatatcaccaaagataaa
accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggct
tccagagagacctctttaataactaatgggcattgtctggcttctggaaagacctctttt
atgacaaccctgtgccttagaagtatctacaaggacttgaagatgtaccacatggagttc
caggccattaatgcaaagcttctgatggatcctaagaggcaagtctctctagaccagaac
atgctggcagctattgctgagctaatgcaggccctgaatttcgacagtgagactgtgcca
cagaaaccctccctggaagaactggatttttacaagacaaaagtcaagctctgcatcctt
cttcacgccttcagaattcgtgcagtgaccatcgacagaatgatgagctatctgagttct
tcctag

DBGET integrated database retrieval system