KEGG   Capra hircus (goat): 100860850
Entry
100860850         CDS       T02910                                 

Gene name
IFNA
Definition
(RefSeq) interferon-alpha
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100860850 (IFNA)
   04151 PI3K-Akt signaling pathway
    100860850 (IFNA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860850 (IFNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100860850 (IFNA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100860850 (IFNA)
   04621 NOD-like receptor signaling pathway
    100860850 (IFNA)
   04622 RIG-I-like receptor signaling pathway
    100860850 (IFNA)
   04623 Cytosolic DNA-sensing pathway
    100860850 (IFNA)
   04650 Natural killer cell mediated cytotoxicity
    100860850 (IFNA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860850 (IFNA)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100860850 (IFNA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100860850 (IFNA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100860850 (IFNA)
   05161 Hepatitis B
    100860850 (IFNA)
   05160 Hepatitis C
    100860850 (IFNA)
   05171 Coronavirus disease - COVID-19
    100860850 (IFNA)
   05164 Influenza A
    100860850 (IFNA)
   05162 Measles
    100860850 (IFNA)
   05168 Herpes simplex virus 1 infection
    100860850 (IFNA)
   05163 Human cytomegalovirus infection
    100860850 (IFNA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860850 (IFNA)
   05169 Epstein-Barr virus infection
    100860850 (IFNA)
   05165 Human papillomavirus infection
    100860850 (IFNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860850 (IFNA)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   100860850 (IFNA)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100860850
NCBI-ProteinID: NP_001272633
UniProt: C5IU72
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHIHSLANGRVLMLLRQLRRVSPSSCLQDRKDFL
FPQEALGGSQLQKAQALSVLHEVTQHTFQLFSTEGTAAAWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcacatccacagcctggccaacgggagggtcctgatgctc
cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttctta
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccctctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggcacggccgccgcgtgg
gaccagagccttctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcatgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggaggaaggactga

KEGG   Capra hircus (goat): 102174842
Entry
102174842         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102174842
   04151 PI3K-Akt signaling pathway
    102174842
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102174842
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102174842
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102174842
   04621 NOD-like receptor signaling pathway
    102174842
   04622 RIG-I-like receptor signaling pathway
    102174842
   04623 Cytosolic DNA-sensing pathway
    102174842
   04650 Natural killer cell mediated cytotoxicity
    102174842
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174842
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102174842
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102174842
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102174842
   05161 Hepatitis B
    102174842
   05160 Hepatitis C
    102174842
   05171 Coronavirus disease - COVID-19
    102174842
   05164 Influenza A
    102174842
   05162 Measles
    102174842
   05168 Herpes simplex virus 1 infection
    102174842
   05163 Human cytomegalovirus infection
    102174842
   05167 Kaposi sarcoma-associated herpesvirus infection
    102174842
   05169 Epstein-Barr virus infection
    102174842
   05165 Human papillomavirus infection
    102174842
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102174842
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102174842
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102174842
NCBI-ProteinID: XP_005683664
UniProt: A0A452DZP2
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSRGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKVQAISVLHEVTHHTFQLFSTEGSAAAWDQSLLDKLRTALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaatgccatctgc
tctcggggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggttcaggccatctctgtgctc
cacgaggtgacccaccacaccttccagctcttcagcaccgagggctcggccgccgcgtgg
gaccagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 102178826
Entry
102178826         CDS       T02910                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102178826
   04151 PI3K-Akt signaling pathway
    102178826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102178826
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102178826
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102178826
   04621 NOD-like receptor signaling pathway
    102178826
   04622 RIG-I-like receptor signaling pathway
    102178826
   04623 Cytosolic DNA-sensing pathway
    102178826
   04650 Natural killer cell mediated cytotoxicity
    102178826
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102178826
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102178826
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102178826
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102178826
   05161 Hepatitis B
    102178826
   05160 Hepatitis C
    102178826
   05171 Coronavirus disease - COVID-19
    102178826
   05164 Influenza A
    102178826
   05162 Measles
    102178826
   05168 Herpes simplex virus 1 infection
    102178826
   05163 Human cytomegalovirus infection
    102178826
   05167 Kaposi sarcoma-associated herpesvirus infection
    102178826
   05169 Epstein-Barr virus infection
    102178826
   05165 Human papillomavirus infection
    102178826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102178826
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102178826
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102178826
NCBI-ProteinID: XP_005683673
LinkDB
Position
Un
AA seq 157 aa
MAKIYLLVAGVILCSTPACPLDNKEIFTRLRQMKTIPSQSCLEHRHDFKFPWRRGNITPI
QMTQGTCYHQLMLQQIFNLFTMESSYAAWNSTLLDKLLSSLGQSLEQLEEVTLDCPDLGT
DVWKYFQRIHLYLKGKEYSPCAWEVVRVEIEKYLSFM
NT seq 474 nt   +upstreamnt  +downstreamnt
atggccaagatctatttgctagtggcaggagtgattctctgctccacccctgcttgtcct
cttgacaacaaagaaatcttcacacgtttgagacagatgaaaacgatcccctcccagtca
tgcctagagcacagacacgacttcaagtttccttggagaagagggaatatcaccccaatc
cagatgactcaaggcacctgttatcaccaactgatgctccagcagatcttcaacctcttc
accatggagagcagctatgctgcttggaacagcaccctcctcgacaaactactctccagc
ctgggtcagagcctggaacagctggaagaagtgactctggattgtcccgatttgggaact
gatgtctggaagtatttccaaagaatccatctctacctgaagggaaaggaatacagcccc
tgtgcctgggaggttgtcagagtagaaattgaaaagtacctttccttcatgtaa

KEGG   Capra hircus (goat): 102179943
Entry
102179943         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102179943
   04151 PI3K-Akt signaling pathway
    102179943
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102179943
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102179943
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102179943
   04621 NOD-like receptor signaling pathway
    102179943
   04622 RIG-I-like receptor signaling pathway
    102179943
   04623 Cytosolic DNA-sensing pathway
    102179943
   04650 Natural killer cell mediated cytotoxicity
    102179943
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102179943
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102179943
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102179943
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102179943
   05161 Hepatitis B
    102179943
   05160 Hepatitis C
    102179943
   05171 Coronavirus disease - COVID-19
    102179943
   05164 Influenza A
    102179943
   05162 Measles
    102179943
   05168 Herpes simplex virus 1 infection
    102179943
   05163 Human cytomegalovirus infection
    102179943
   05167 Kaposi sarcoma-associated herpesvirus infection
    102179943
   05169 Epstein-Barr virus infection
    102179943
   05165 Human papillomavirus infection
    102179943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102179943
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102179943
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102179943
NCBI-ProteinID: XP_017908297
UniProt: A0A452DRM0
LinkDB
Position
8
AA seq 189 aa
MAAAWSLLLALLLLSCNAICSWGCHLPHTHSLANGRVLMLLRQLRRVSPSSCLQDRKDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSIN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccgcagcctggtccttactcctggctttgctgctgctcagctgcaacgccatctgc
tcttggggctgccacctgcctcacacccacagcctggccaacgggagggttctgatgctc
ctgcgacaactgaggagagtctccccttcctcctgcctgcaggacagaaaagacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcaccgagggctcggccgccgcgtgg
gaccagagcctcctggacaagctccgtgctgcactggatcagcagctcactgacctgcaa
gcatgtctcaggcaggaggaggggctgcgaggggctcctctgctcaaggaggattccagc
ctggctgtgaggaaatactttcacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaataaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 102180761
Entry
102180761         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102180761
   04151 PI3K-Akt signaling pathway
    102180761
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102180761
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102180761
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102180761
   04621 NOD-like receptor signaling pathway
    102180761
   04622 RIG-I-like receptor signaling pathway
    102180761
   04623 Cytosolic DNA-sensing pathway
    102180761
   04650 Natural killer cell mediated cytotoxicity
    102180761
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180761
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102180761
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102180761
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102180761
   05161 Hepatitis B
    102180761
   05160 Hepatitis C
    102180761
   05171 Coronavirus disease - COVID-19
    102180761
   05164 Influenza A
    102180761
   05162 Measles
    102180761
   05168 Herpes simplex virus 1 infection
    102180761
   05163 Human cytomegalovirus infection
    102180761
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180761
   05169 Epstein-Barr virus infection
    102180761
   05165 Human papillomavirus infection
    102180761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102180761
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102180761
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102180761
NCBI-ProteinID: XP_017908295
UniProt: A0A452E5Z1
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRKDFT
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctaggctgccacctgcctcacacccacagcctggccaacaggagggtcttgacgctc
cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcaca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg
gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcgtgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 102181299
Entry
102181299         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102181299
   04151 PI3K-Akt signaling pathway
    102181299
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102181299
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102181299
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102181299
   04621 NOD-like receptor signaling pathway
    102181299
   04622 RIG-I-like receptor signaling pathway
    102181299
   04623 Cytosolic DNA-sensing pathway
    102181299
   04650 Natural killer cell mediated cytotoxicity
    102181299
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102181299
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102181299
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102181299
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102181299
   05161 Hepatitis B
    102181299
   05160 Hepatitis C
    102181299
   05171 Coronavirus disease - COVID-19
    102181299
   05164 Influenza A
    102181299
   05162 Measles
    102181299
   05168 Herpes simplex virus 1 infection
    102181299
   05163 Human cytomegalovirus infection
    102181299
   05167 Kaposi sarcoma-associated herpesvirus infection
    102181299
   05169 Epstein-Barr virus infection
    102181299
   05165 Human papillomavirus infection
    102181299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102181299
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102181299
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102181299
NCBI-ProteinID: XP_017908249
LinkDB
Position
8
AA seq 166 aa
MTLTNLLNFTYQRVLMLLRQLKRVSPSSCLQDRKDFTFPQEALGGSQLQKAQAISVLHEV
TQHTFQLFSTEGSAAARDQSLLDKLRTALEKQLNDLQACLRQEEGLRGAPLLKEDSSLAV
RKYFHRVTLYLQEKGHSPCDWEVVRAEVMRAFSSSTNLQERFRSKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atgacattaaccaacttgcttaacttcacgtatcagagggtcctgatgctcctgcgacaa
ctgaagagggtctccccttcctcctgcctgcaggacagaaaagacttcacattcccccag
gaggcactgggtggcagccagttgcagaaggctcaagccatctctgtgctccacgaggtg
acccagcacaccttccagctcttcagcacagagggctcggccgccgcgcgggaccagagc
ctcctggacaagctccgcactgctctggaaaagcagctcaatgacctgcaagcatgtctc
aggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagcctggctgtg
aggaaatactttcacagagtcactctctatctgcaagagaagggacacagtccttgtgac
tgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttgcaggag
agattcaggagcaaggactga

KEGG   Capra hircus (goat): 108633160
Entry
108633160         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108633160
   04151 PI3K-Akt signaling pathway
    108633160
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108633160
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108633160
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108633160
   04621 NOD-like receptor signaling pathway
    108633160
   04622 RIG-I-like receptor signaling pathway
    108633160
   04623 Cytosolic DNA-sensing pathway
    108633160
   04650 Natural killer cell mediated cytotoxicity
    108633160
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108633160
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108633160
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108633160
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108633160
   05161 Hepatitis B
    108633160
   05160 Hepatitis C
    108633160
   05171 Coronavirus disease - COVID-19
    108633160
   05164 Influenza A
    108633160
   05162 Measles
    108633160
   05168 Herpes simplex virus 1 infection
    108633160
   05163 Human cytomegalovirus infection
    108633160
   05167 Kaposi sarcoma-associated herpesvirus infection
    108633160
   05169 Epstein-Barr virus infection
    108633160
   05165 Human papillomavirus infection
    108633160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108633160
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108633160
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108633160
NCBI-ProteinID: XP_017900214
UniProt: A0A452F8F9
LinkDB
Position
Un
AA seq 189 aa
MAAAWSLLLALLLLSCNAICSLGCHLPHAHSLANRRVLMLLRQLKSVSPFSCLQDRNDFA
FPQEALGGSQLQKVQAISVLHEVTQHTFQLFSTEGLATAWDQSLLDKLRTTLDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccgcagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcacgcccacagcctggccaacaggagggtcctgatgctc
ctgcgacaactgaagagtgtctcccctttctcctgcctgcaagacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggttcaggccatctctgtgctc
cacgaggtgacccagcacaccttccagctctttagcacagagggcttggccaccgcgtgg
gaccagagcctcctggacaagctccgcaccacactggatcagcagctcactgacctgcaa
gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 108635529
Entry
108635529         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108635529
   04151 PI3K-Akt signaling pathway
    108635529
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108635529
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108635529
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108635529
   04621 NOD-like receptor signaling pathway
    108635529
   04622 RIG-I-like receptor signaling pathway
    108635529
   04623 Cytosolic DNA-sensing pathway
    108635529
   04650 Natural killer cell mediated cytotoxicity
    108635529
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108635529
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108635529
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108635529
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108635529
   05161 Hepatitis B
    108635529
   05160 Hepatitis C
    108635529
   05171 Coronavirus disease - COVID-19
    108635529
   05164 Influenza A
    108635529
   05162 Measles
    108635529
   05168 Herpes simplex virus 1 infection
    108635529
   05163 Human cytomegalovirus infection
    108635529
   05167 Kaposi sarcoma-associated herpesvirus infection
    108635529
   05169 Epstein-Barr virus infection
    108635529
   05165 Human papillomavirus infection
    108635529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108635529
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108635529
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108635529
NCBI-ProteinID: XP_017901124
LinkDB
Position
Un
AA seq 189 aa
MAAAWSLLLALLLLSCNAICSRGCHLPHAHSLANRGVLMLLRQLKSVSPFSCLQDRNDFS
FPQEVLGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLCAALDQQLTDLQ
ACLRQEEGLRGAPLPKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccgcagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctcggggctgccacctgcctcacgcccacagcctggccaacaggggggtcctgatgctc
ctgcgacaactgaagagtgtctcccctttctcctgcctgcaggacagaaatgacttctca
ttcccccaggaggtgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg
gaccagagcctcctggacaagctctgcgctgcactggatcagcagctcactgacctgcaa
gcatgtctcaggcaggaggaggggctgcgaggggctcccctgcccaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 108636621
Entry
108636621         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636621
   04151 PI3K-Akt signaling pathway
    108636621
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636621
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636621
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636621
   04621 NOD-like receptor signaling pathway
    108636621
   04622 RIG-I-like receptor signaling pathway
    108636621
   04623 Cytosolic DNA-sensing pathway
    108636621
   04650 Natural killer cell mediated cytotoxicity
    108636621
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108636621
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108636621
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108636621
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636621
   05161 Hepatitis B
    108636621
   05160 Hepatitis C
    108636621
   05171 Coronavirus disease - COVID-19
    108636621
   05164 Influenza A
    108636621
   05162 Measles
    108636621
   05168 Herpes simplex virus 1 infection
    108636621
   05163 Human cytomegalovirus infection
    108636621
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636621
   05169 Epstein-Barr virus infection
    108636621
   05165 Human papillomavirus infection
    108636621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636621
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636621
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636621
NCBI-ProteinID: XP_017908294
UniProt: A0A452DN65
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRKDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEVSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg
gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggtctccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcgtgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

KEGG   Capra hircus (goat): 108636627
Entry
108636627         CDS       T02910                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108636627
   04151 PI3K-Akt signaling pathway
    108636627
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108636627
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636627
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636627
   04621 NOD-like receptor signaling pathway
    108636627
   04622 RIG-I-like receptor signaling pathway
    108636627
   04623 Cytosolic DNA-sensing pathway
    108636627
   04650 Natural killer cell mediated cytotoxicity
    108636627
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108636627
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108636627
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108636627
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108636627
   05161 Hepatitis B
    108636627
   05160 Hepatitis C
    108636627
   05171 Coronavirus disease - COVID-19
    108636627
   05164 Influenza A
    108636627
   05162 Measles
    108636627
   05168 Herpes simplex virus 1 infection
    108636627
   05163 Human cytomegalovirus infection
    108636627
   05167 Kaposi sarcoma-associated herpesvirus infection
    108636627
   05169 Epstein-Barr virus infection
    108636627
   05165 Human papillomavirus infection
    108636627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    108636627
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   108636627
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 108636627
NCBI-ProteinID: XP_017908304
UniProt: A0A452E209
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSWGCHLPHTHSLANKRVLTLLGQLRRVPPSSCLQDRNDFA
LPQEALGGSQLRKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLPKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVREEVMRAFSSSTN
LQERFRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtctttactcctggccctgctgctgctcagctgcaacgccatctgt
tcttggggctgccacctgcctcacacccacagcctggccaacaagagggtgctgacgctc
ctgggacaactgaggagggtccccccttcctcctgcctgcaggacagaaatgacttcgca
ttaccccaggaggcgctgggtggcagccagttgcggaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg
gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcatgtctcaggcaggaggaggggctgcgaggggctcccctgcccaaggaggactccagc
ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc
ccttgtgcctgggaggttgtcagagaagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system