Capra hircus (goat): 100860850 Help Entry 100860850         CDS       T02910                                  Gene name IFNA Definition (RefSeq) interferon-alpha   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100860850 (IFNA)    04151 PI3K-Akt signaling pathway     100860850 (IFNA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100860850 (IFNA)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100860850 (IFNA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100860850 (IFNA)    04621 NOD-like receptor signaling pathway     100860850 (IFNA)    04622 RIG-I-like receptor signaling pathway     100860850 (IFNA)    04623 Cytosolic DNA-sensing pathway     100860850 (IFNA)    04650 Natural killer cell mediated cytotoxicity     100860850 (IFNA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100860850 (IFNA)   09163 Immune disease    05320 Autoimmune thyroid disease     100860850 (IFNA)   09171 Infectious disease: bacterial    05152 Tuberculosis     100860850 (IFNA)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100860850 (IFNA)    05161 Hepatitis B     100860850 (IFNA)    05160 Hepatitis C     100860850 (IFNA)    05171 Coronavirus disease - COVID-19     100860850 (IFNA)    05164 Influenza A     100860850 (IFNA)    05162 Measles     100860850 (IFNA)    05168 Herpes simplex virus 1 infection     100860850 (IFNA)    05163 Human cytomegalovirus infection     100860850 (IFNA)    05167 Kaposi sarcoma-associated herpesvirus infection     100860850 (IFNA)    05169 Epstein-Barr virus infection     100860850 (IFNA)    05165 Human papillomavirus infection     100860850 (IFNA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     100860850 (IFNA) Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    100860850 (IFNA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100860850 NCBI-ProteinID:  NP_001272633 UniProt:  C5IU72 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHIHSLANGRVLMLLRQLRRVSPSSCLQDRKDFL FPQEALGGSQLQKAQALSVLHEVTQHTFQLFSTEGTAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacatccacagcctggccaacgggagggtcctgatgctc cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttctta ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccctctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggcacggccgccgcgtgg gaccagagccttctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcatgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggaggaaggactga

Capra hircus (goat): 102174842 Help Entry 102174842         CDS       T02910                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102174842    04151 PI3K-Akt signaling pathway     102174842   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102174842  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102174842  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102174842    04621 NOD-like receptor signaling pathway     102174842    04622 RIG-I-like receptor signaling pathway     102174842    04623 Cytosolic DNA-sensing pathway     102174842    04650 Natural killer cell mediated cytotoxicity     102174842  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102174842   09163 Immune disease    05320 Autoimmune thyroid disease     102174842   09171 Infectious disease: bacterial    05152 Tuberculosis     102174842   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102174842    05161 Hepatitis B     102174842    05160 Hepatitis C     102174842    05171 Coronavirus disease - COVID-19     102174842    05164 Influenza A     102174842    05162 Measles     102174842    05168 Herpes simplex virus 1 infection     102174842    05163 Human cytomegalovirus infection     102174842    05167 Kaposi sarcoma-associated herpesvirus infection     102174842    05169 Epstein-Barr virus infection     102174842    05165 Human papillomavirus infection     102174842  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102174842 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102174842 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102174842 NCBI-ProteinID:  XP_005683664 UniProt:  A0A452DZP2 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSRGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKVQAISVLHEVTHHTFQLFSTEGSAAAWDQSLLDKLRTALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaatgccatctgc tctcggggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggttcaggccatctctgtgctc cacgaggtgacccaccacaccttccagctcttcagcaccgagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 102178826 Help Entry 102178826         CDS       T02910                                  Definition (RefSeq) interferon omega-1-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102178826    04151 PI3K-Akt signaling pathway     102178826   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102178826  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102178826  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102178826    04621 NOD-like receptor signaling pathway     102178826    04622 RIG-I-like receptor signaling pathway     102178826    04623 Cytosolic DNA-sensing pathway     102178826    04650 Natural killer cell mediated cytotoxicity     102178826  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102178826   09163 Immune disease    05320 Autoimmune thyroid disease     102178826   09171 Infectious disease: bacterial    05152 Tuberculosis     102178826   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102178826    05161 Hepatitis B     102178826    05160 Hepatitis C     102178826    05171 Coronavirus disease - COVID-19     102178826    05164 Influenza A     102178826    05162 Measles     102178826    05168 Herpes simplex virus 1 infection     102178826    05163 Human cytomegalovirus infection     102178826    05167 Kaposi sarcoma-associated herpesvirus infection     102178826    05169 Epstein-Barr virus infection     102178826    05165 Human papillomavirus infection     102178826  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102178826 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102178826 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102178826 NCBI-ProteinID:  XP_005683673 LinkDB All DBs Position Un AA seq 157 aa AA seqDB search MAKIYLLVAGVILCSTPACPLDNKEIFTRLRQMKTIPSQSCLEHRHDFKFPWRRGNITPI QMTQGTCYHQLMLQQIFNLFTMESSYAAWNSTLLDKLLSSLGQSLEQLEEVTLDCPDLGT DVWKYFQRIHLYLKGKEYSPCAWEVVRVEIEKYLSFM NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggccaagatctatttgctagtggcaggagtgattctctgctccacccctgcttgtcct cttgacaacaaagaaatcttcacacgtttgagacagatgaaaacgatcccctcccagtca tgcctagagcacagacacgacttcaagtttccttggagaagagggaatatcaccccaatc cagatgactcaaggcacctgttatcaccaactgatgctccagcagatcttcaacctcttc accatggagagcagctatgctgcttggaacagcaccctcctcgacaaactactctccagc ctgggtcagagcctggaacagctggaagaagtgactctggattgtcccgatttgggaact gatgtctggaagtatttccaaagaatccatctctacctgaagggaaaggaatacagcccc tgtgcctgggaggttgtcagagtagaaattgaaaagtacctttccttcatgtaa

Capra hircus (goat): 102179943 Help Entry 102179943         CDS       T02910                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102179943    04151 PI3K-Akt signaling pathway     102179943   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102179943  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102179943  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102179943    04621 NOD-like receptor signaling pathway     102179943    04622 RIG-I-like receptor signaling pathway     102179943    04623 Cytosolic DNA-sensing pathway     102179943    04650 Natural killer cell mediated cytotoxicity     102179943  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102179943   09163 Immune disease    05320 Autoimmune thyroid disease     102179943   09171 Infectious disease: bacterial    05152 Tuberculosis     102179943   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102179943    05161 Hepatitis B     102179943    05160 Hepatitis C     102179943    05171 Coronavirus disease - COVID-19     102179943    05164 Influenza A     102179943    05162 Measles     102179943    05168 Herpes simplex virus 1 infection     102179943    05163 Human cytomegalovirus infection     102179943    05167 Kaposi sarcoma-associated herpesvirus infection     102179943    05169 Epstein-Barr virus infection     102179943    05165 Human papillomavirus infection     102179943  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102179943 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102179943 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102179943 NCBI-ProteinID:  XP_017908297 UniProt:  A0A452DRM0 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSWGCHLPHTHSLANGRVLMLLRQLRRVSPSSCLQDRKDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSIN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggctttgctgctgctcagctgcaacgccatctgc tcttggggctgccacctgcctcacacccacagcctggccaacgggagggttctgatgctc ctgcgacaactgaggagagtctccccttcctcctgcctgcaggacagaaaagacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcaccgagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgtgctgcactggatcagcagctcactgacctgcaa gcatgtctcaggcaggaggaggggctgcgaggggctcctctgctcaaggaggattccagc ctggctgtgaggaaatactttcacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaataaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 102180761 Help Entry 102180761         CDS       T02910                                  Definition (RefSeq) interferon alpha-H   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102180761    04151 PI3K-Akt signaling pathway     102180761   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102180761  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102180761  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102180761    04621 NOD-like receptor signaling pathway     102180761    04622 RIG-I-like receptor signaling pathway     102180761    04623 Cytosolic DNA-sensing pathway     102180761    04650 Natural killer cell mediated cytotoxicity     102180761  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102180761   09163 Immune disease    05320 Autoimmune thyroid disease     102180761   09171 Infectious disease: bacterial    05152 Tuberculosis     102180761   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102180761    05161 Hepatitis B     102180761    05160 Hepatitis C     102180761    05171 Coronavirus disease - COVID-19     102180761    05164 Influenza A     102180761    05162 Measles     102180761    05168 Herpes simplex virus 1 infection     102180761    05163 Human cytomegalovirus infection     102180761    05167 Kaposi sarcoma-associated herpesvirus infection     102180761    05169 Epstein-Barr virus infection     102180761    05165 Human papillomavirus infection     102180761  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102180761 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102180761 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102180761 NCBI-ProteinID:  XP_017908295 UniProt:  A0A452E5Z1 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRKDFT FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctaggctgccacctgcctcacacccacagcctggccaacaggagggtcttgacgctc cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcaca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcgtgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 102181299 Help Entry 102181299         CDS       T02910                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102181299    04151 PI3K-Akt signaling pathway     102181299   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102181299  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102181299  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102181299    04621 NOD-like receptor signaling pathway     102181299    04622 RIG-I-like receptor signaling pathway     102181299    04623 Cytosolic DNA-sensing pathway     102181299    04650 Natural killer cell mediated cytotoxicity     102181299  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102181299   09163 Immune disease    05320 Autoimmune thyroid disease     102181299   09171 Infectious disease: bacterial    05152 Tuberculosis     102181299   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102181299    05161 Hepatitis B     102181299    05160 Hepatitis C     102181299    05171 Coronavirus disease - COVID-19     102181299    05164 Influenza A     102181299    05162 Measles     102181299    05168 Herpes simplex virus 1 infection     102181299    05163 Human cytomegalovirus infection     102181299    05167 Kaposi sarcoma-associated herpesvirus infection     102181299    05169 Epstein-Barr virus infection     102181299    05165 Human papillomavirus infection     102181299  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     102181299 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    102181299 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102181299 NCBI-ProteinID:  XP_017908249 LinkDB All DBs Position 8 AA seq 166 aa AA seqDB search MTLTNLLNFTYQRVLMLLRQLKRVSPSSCLQDRKDFTFPQEALGGSQLQKAQAISVLHEV TQHTFQLFSTEGSAAARDQSLLDKLRTALEKQLNDLQACLRQEEGLRGAPLLKEDSSLAV RKYFHRVTLYLQEKGHSPCDWEVVRAEVMRAFSSSTNLQERFRSKD NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgacattaaccaacttgcttaacttcacgtatcagagggtcctgatgctcctgcgacaa ctgaagagggtctccccttcctcctgcctgcaggacagaaaagacttcacattcccccag gaggcactgggtggcagccagttgcagaaggctcaagccatctctgtgctccacgaggtg acccagcacaccttccagctcttcagcacagagggctcggccgccgcgcgggaccagagc ctcctggacaagctccgcactgctctggaaaagcagctcaatgacctgcaagcatgtctc aggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagcctggctgtg aggaaatactttcacagagtcactctctatctgcaagagaagggacacagtccttgtgac tgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttgcaggag agattcaggagcaaggactga

Capra hircus (goat): 108633160 Help Entry 108633160         CDS       T02910                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108633160    04151 PI3K-Akt signaling pathway     108633160   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108633160  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108633160  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108633160    04621 NOD-like receptor signaling pathway     108633160    04622 RIG-I-like receptor signaling pathway     108633160    04623 Cytosolic DNA-sensing pathway     108633160    04650 Natural killer cell mediated cytotoxicity     108633160  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108633160   09163 Immune disease    05320 Autoimmune thyroid disease     108633160   09171 Infectious disease: bacterial    05152 Tuberculosis     108633160   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108633160    05161 Hepatitis B     108633160    05160 Hepatitis C     108633160    05171 Coronavirus disease - COVID-19     108633160    05164 Influenza A     108633160    05162 Measles     108633160    05168 Herpes simplex virus 1 infection     108633160    05163 Human cytomegalovirus infection     108633160    05167 Kaposi sarcoma-associated herpesvirus infection     108633160    05169 Epstein-Barr virus infection     108633160    05165 Human papillomavirus infection     108633160  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108633160 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108633160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108633160 NCBI-ProteinID:  XP_017900214 UniProt:  A0A452F8F9 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSLGCHLPHAHSLANRRVLMLLRQLKSVSPFSCLQDRNDFA FPQEALGGSQLQKVQAISVLHEVTQHTFQLFSTEGLATAWDQSLLDKLRTTLDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRVTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacgcccacagcctggccaacaggagggtcctgatgctc ctgcgacaactgaagagtgtctcccctttctcctgcctgcaagacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggttcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctctttagcacagagggcttggccaccgcgtgg gaccagagcctcctggacaagctccgcaccacactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 108635529 Help Entry 108635529         CDS       T02910                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108635529    04151 PI3K-Akt signaling pathway     108635529   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108635529  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108635529  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108635529    04621 NOD-like receptor signaling pathway     108635529    04622 RIG-I-like receptor signaling pathway     108635529    04623 Cytosolic DNA-sensing pathway     108635529    04650 Natural killer cell mediated cytotoxicity     108635529  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108635529   09163 Immune disease    05320 Autoimmune thyroid disease     108635529   09171 Infectious disease: bacterial    05152 Tuberculosis     108635529   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108635529    05161 Hepatitis B     108635529    05160 Hepatitis C     108635529    05171 Coronavirus disease - COVID-19     108635529    05164 Influenza A     108635529    05162 Measles     108635529    05168 Herpes simplex virus 1 infection     108635529    05163 Human cytomegalovirus infection     108635529    05167 Kaposi sarcoma-associated herpesvirus infection     108635529    05169 Epstein-Barr virus infection     108635529    05165 Human papillomavirus infection     108635529  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108635529 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108635529 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108635529 NCBI-ProteinID:  XP_017901124 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MAAAWSLLLALLLLSCNAICSRGCHLPHAHSLANRGVLMLLRQLKSVSPFSCLQDRNDFS FPQEVLGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLCAALDQQLTDLQ ACLRQEEGLRGAPLPKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgcagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctcggggctgccacctgcctcacgcccacagcctggccaacaggggggtcctgatgctc ctgcgacaactgaagagtgtctcccctttctcctgcctgcaggacagaaatgacttctca ttcccccaggaggtgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccagagcctcctggacaagctctgcgctgcactggatcagcagctcactgacctgcaa gcatgtctcaggcaggaggaggggctgcgaggggctcccctgcccaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 108636621 Help Entry 108636621         CDS       T02910                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636621    04151 PI3K-Akt signaling pathway     108636621   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636621  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636621  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636621    04621 NOD-like receptor signaling pathway     108636621    04622 RIG-I-like receptor signaling pathway     108636621    04623 Cytosolic DNA-sensing pathway     108636621    04650 Natural killer cell mediated cytotoxicity     108636621  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108636621   09163 Immune disease    05320 Autoimmune thyroid disease     108636621   09171 Infectious disease: bacterial    05152 Tuberculosis     108636621   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636621    05161 Hepatitis B     108636621    05160 Hepatitis C     108636621    05171 Coronavirus disease - COVID-19     108636621    05164 Influenza A     108636621    05162 Measles     108636621    05168 Herpes simplex virus 1 infection     108636621    05163 Human cytomegalovirus infection     108636621    05167 Kaposi sarcoma-associated herpesvirus infection     108636621    05169 Epstein-Barr virus infection     108636621    05165 Human papillomavirus infection     108636621  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636621 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636621 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636621 NCBI-ProteinID:  XP_017908294 UniProt:  A0A452DN65 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRKDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEVSSLAVRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc cttcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaaagacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctcaggcaggaggaggggctgcgaggggctcccctgctcaaggaggtctccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcgtgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

Capra hircus (goat): 108636627 Help Entry 108636627         CDS       T02910                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636627    04151 PI3K-Akt signaling pathway     108636627   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636627  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636627  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636627    04621 NOD-like receptor signaling pathway     108636627    04622 RIG-I-like receptor signaling pathway     108636627    04623 Cytosolic DNA-sensing pathway     108636627    04650 Natural killer cell mediated cytotoxicity     108636627  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108636627   09163 Immune disease    05320 Autoimmune thyroid disease     108636627   09171 Infectious disease: bacterial    05152 Tuberculosis     108636627   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636627    05161 Hepatitis B     108636627    05160 Hepatitis C     108636627    05171 Coronavirus disease - COVID-19     108636627    05164 Influenza A     108636627    05162 Measles     108636627    05168 Herpes simplex virus 1 infection     108636627    05163 Human cytomegalovirus infection     108636627    05167 Kaposi sarcoma-associated herpesvirus infection     108636627    05169 Epstein-Barr virus infection     108636627    05165 Human papillomavirus infection     108636627  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:chx04052]     108636627 Cytokines and growth factors [BR:chx04052]  Cytokines   Interferons    108636627 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  108636627 NCBI-ProteinID:  XP_017908304 UniProt:  A0A452E209 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSWGCHLPHTHSLANKRVLTLLGQLRRVPPSSCLQDRNDFA LPQEALGGSQLRKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLPKEDSSLAVRKYFHRVTLYLQEKGHSPCAWEVVREEVMRAFSSSTN LQERFRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtctttactcctggccctgctgctgctcagctgcaacgccatctgt tcttggggctgccacctgcctcacacccacagcctggccaacaagagggtgctgacgctc ctgggacaactgaggagggtccccccttcctcctgcctgcaggacagaaatgacttcgca ttaccccaggaggcgctgggtggcagccagttgcggaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccgcgtgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcatgtctcaggcaggaggaggggctgcgaggggctcccctgcccaaggaggactccagc ctggctgtgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagaagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagcaaggactga

DBGET integrated database retrieval system