KEGG   Capra hircus (goat): 100860856Help
Entry
100860856         CDS       T02910                                 

Gene name
SOD2, MNSOD
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04068  FoxO signaling pathway
chx04146  Peroxisome
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100860856 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100860856 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100860856 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100860856 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100860856 (SOD2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100860856 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100860856
NCBI-ProteinID: XP_017908917
LinkDB All DBs
Position
9
AA seq 222 aa AA seqDB search
MLSRAACSTSRKLVPALGVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgggcggcgtgcagcacgagcaggaaactggtgccggccctgggcgtgctg
ggctcccggcagaagcacagcctccccgacctgccgtacgactacggcgccctggagccg
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctcaacgtcgccgaggagaagtaccgggaggcgctggagaagggtgatgtcacagct
cagatagctctgcagcctgcgttaaagttcaacggtgggggccatatcaatcacagcatc
ttctggacaaatctgagccccaacggtggtggagaacccaaaggggaattgctggaagcc
atcaaacgtgactttggttcctttgccaaatttaaggaaaagctgactgctgtatctgtt
ggtgtccaaggttccggttggggttggcttggcttcaataaggagcagggacgcttgcag
attgctgcttgttctaaccaggatcccctgcaaggaacaacaggtcttatccccctgctg
gggattgacgtgtgggagcatgcttattaccttcagtataaaaatgtcaggcccgattat
ctgaaggccatttggaacgtgatcaactgggagaatgtaactgcacgatacacggcttgc
agcaagtaa

DBGET integrated database retrieval system