KEGG   Capra hircus (goat): 100860873
Entry
100860873         CDS       T02910                                 

Gene name
CXCL10, IP-10
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04062  Chemokine signaling pathway
chx04620  Toll-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04657  IL-17 signaling pathway
chx04668  TNF signaling pathway
chx05160  Hepatitis C
chx05164  Influenza A
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100860873 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100860873 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100860873 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100860873 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    100860873 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    100860873 (CXCL10)
   04657 IL-17 signaling pathway
    100860873 (CXCL10)
   04062 Chemokine signaling pathway
    100860873 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100860873 (CXCL10)
   05171 Coronavirus disease - COVID-19
    100860873 (CXCL10)
   05164 Influenza A
    100860873 (CXCL10)
   05169 Epstein-Barr virus infection
    100860873 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860873 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100860873 (CXCL10)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Chemokines
   100860873 (CXCL10)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Chemokines
   100860873 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100860873
NCBI-ProteinID: NP_001272650
UniProt: Q867B3
LinkDB
Position
6
AA seq 102 aa
MNTSGFLIFCLILLTLSQGIPLSRNTRCTCIEISNGSVNPRSLEKLELIPASQSCPRVEI
IATMKRNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaacacaagtggttttcttattttctgccttatccttctgactctgagtcaaggcata
cctctctctaggaatacacgctgtacctgcatcgagatcagtaatggatctgttaatcca
aggtccttagaaaaacttgaactgattcctgcaagtcaatcctgcccacgtgtcgagatt
attgccacaatgaaaaggaatggggagaaaagatgtctgaatccagaatctaagaccatc
aagaatttactgaaagcaattaacaagcaaaggactaaaagatctcctcgaacacggaaa
gaggcataa

DBGET integrated database retrieval system