KEGG   Capra hircus (goat): 100860883
Entry
100860883         CDS       T02910                                 

Gene name
ACTG1, ACTB
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04145  Phagosome
chx04210  Apoptosis
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04530  Tight junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04670  Leukocyte transendothelial migration
chx04714  Thermogenesis
chx04810  Regulation of actin cytoskeleton
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
chx05014  Amyotrophic lateral sclerosis
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05164  Influenza A
chx05205  Proteoglycans in cancer
chx05225  Hepatocellular carcinoma
chx05410  Hypertrophic cardiomyopathy
chx05412  Arrhythmogenic right ventricular cardiomyopathy
chx05414  Dilated cardiomyopathy
chx05416  Viral myocarditis
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100860883 (ACTG1)
   04390 Hippo signaling pathway
    100860883 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100860883 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    100860883 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100860883 (ACTG1)
   04520 Adherens junction
    100860883 (ACTG1)
   04530 Tight junction
    100860883 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100860883 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100860883 (ACTG1)
   04613 Neutrophil extracellular trap formation
    100860883 (ACTG1)
   04670 Leukocyte transendothelial migration
    100860883 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100860883 (ACTG1)
   04919 Thyroid hormone signaling pathway
    100860883 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    100860883 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100860883 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100860883 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100860883 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100860883 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100860883 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    100860883 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100860883 (ACTG1)
   05414 Dilated cardiomyopathy
    100860883 (ACTG1)
   05416 Viral myocarditis
    100860883 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860883 (ACTG1)
   05135 Yersinia infection
    100860883 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    100860883 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    100860883 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:chx03021]
    100860883 (ACTG1)
   03019 Messenger RNA biogenesis [BR:chx03019]
    100860883 (ACTG1)
   03036 Chromosome and associated proteins [BR:chx03036]
    100860883 (ACTG1)
   03029 Mitochondrial biogenesis [BR:chx03029]
    100860883 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:chx04812]
    100860883 (ACTG1)
   04147 Exosome [BR:chx04147]
    100860883 (ACTG1)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100860883 (ACTG1)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100860883 (ACTG1)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100860883 (ACTG1)
    NuA4 complex
     100860883 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    100860883 (ACTG1)
   PBAF complex
    100860883 (ACTG1)
   SWR1 complex
    100860883 (ACTG1)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100860883 (ACTG1)
Cytoskeleton proteins [BR:chx04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100860883 (ACTG1)
Exosome [BR:chx04147]
 Exosomal proteins
  Proteins found in most exosomes
   100860883 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100860883
NCBI-ProteinID: XP_017919092
UniProt: A0A452G8J3
LinkDB
Position
19
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaattgccgccctcgtcatcgacaatggttctggcatgtgcaaagctggc
tttgctggggatgacgccccccgggccgtgttcccgtccatcgttgggcgtccccgacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc
aagcgtggcatcctaacccttaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag
caccccgtgctgctgacggaggcccctctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagactttcaacactcctgccatgtatgtggccatccaggctgtgctg
tccctgtacgcctctggccgcaccactggcattgtcatggactctggggacggggtcacc
cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctcacggaacgtggttacagcttt
accaccacagccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtcgcc
ctggacttcgagcaggagatggctactgctgcgtcgtcctcctccttggagaagagctat
gagctgcccgatggtcaggtgatcaccattggcaacgagcggttccggtgtcccgaggcg
ctcttccagccgtccttcctgggtatggagtcctgtggcatccacgagaccaccttcaat
tccatcatgaagtgtgacgtggacatccgaaaggacctgtatgccaacacggtgctgtct
ggtggcaccaccatgtaccctggcatcgccgacaggatgcagaaggagatcaccgcgctg
gctccgagcacgatgaagatcaagatcatcgctcctcccgagcgcaagtactcggtgtgg
atcggaggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtctggcccctccattgtccaccgcaaatgcttctaa

KEGG   Capra hircus (goat): 102179831
Entry
102179831         CDS       T02910                                 

Gene name
ACTB, beta-actin
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04145  Phagosome
chx04210  Apoptosis
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04530  Tight junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04670  Leukocyte transendothelial migration
chx04714  Thermogenesis
chx04810  Regulation of actin cytoskeleton
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04971  Gastric acid secretion
chx05014  Amyotrophic lateral sclerosis
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05164  Influenza A
chx05205  Proteoglycans in cancer
chx05225  Hepatocellular carcinoma
chx05410  Hypertrophic cardiomyopathy
chx05412  Arrhythmogenic right ventricular cardiomyopathy
chx05414  Dilated cardiomyopathy
chx05416  Viral myocarditis
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102179831 (ACTB)
   04390 Hippo signaling pathway
    102179831 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102179831 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    102179831 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102179831 (ACTB)
   04520 Adherens junction
    102179831 (ACTB)
   04530 Tight junction
    102179831 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102179831 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102179831 (ACTB)
   04613 Neutrophil extracellular trap formation
    102179831 (ACTB)
   04670 Leukocyte transendothelial migration
    102179831 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102179831 (ACTB)
   04919 Thyroid hormone signaling pathway
    102179831 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    102179831 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    102179831 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102179831 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102179831 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102179831 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102179831 (ACTB)
   05410 Hypertrophic cardiomyopathy
    102179831 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102179831 (ACTB)
   05414 Dilated cardiomyopathy
    102179831 (ACTB)
   05416 Viral myocarditis
    102179831 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102179831 (ACTB)
   05135 Yersinia infection
    102179831 (ACTB)
   05100 Bacterial invasion of epithelial cells
    102179831 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    102179831 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:chx03021]
    102179831 (ACTB)
   03019 Messenger RNA biogenesis [BR:chx03019]
    102179831 (ACTB)
   03036 Chromosome and associated proteins [BR:chx03036]
    102179831 (ACTB)
   03029 Mitochondrial biogenesis [BR:chx03029]
    102179831 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:chx04812]
    102179831 (ACTB)
   04147 Exosome [BR:chx04147]
    102179831 (ACTB)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102179831 (ACTB)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102179831 (ACTB)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     102179831 (ACTB)
    NuA4 complex
     102179831 (ACTB)
  Chromatin remodeling factors
   BAF complex
    102179831 (ACTB)
   PBAF complex
    102179831 (ACTB)
   SWR1 complex
    102179831 (ACTB)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    102179831 (ACTB)
Cytoskeleton proteins [BR:chx04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     102179831 (ACTB)
Exosome [BR:chx04147]
 Exosomal proteins
  Proteins found in most exosomes
   102179831 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 102179831
NCBI-ProteinID: NP_001301271
UniProt: I6W7A2
LinkDB
Position
25
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIGHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAERGIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatattgctgcgctcgtggttgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccttccatcgtggggcgcccccggcac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggggatgaggctcagagc
aagagaggcatcctgaccctcaagtaccccattgggcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgtttgagaccttcaacacccctgccatgtacgtggccatccaggctgtgctg
tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggtgacggggtcacc
cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagattctcacggagcgtggctacagcttc
accaccacggccgagcggggaatcgtccgtgacatcaaggagaagctctgctacgtggcc
ctggacttcgagcaggagatggccaccgcggcctccagctcctccctggagaagagctac
gagctgccggacgggcaggtcatcaccattggcaatgagcggttccgctgccctgaggct
ctcttccagccttccttcctgggcatggaatcctgcggcattcacgaaactaccttcaat
tccatcatgaagtgtgatgtcgacatccgcaaggacctttacgccaacacggtgctgtcc
ggcgggaccaccatgtaccctggcatcgcagacaggatgcagaaagagatcactgccctg
gcacccagcacgatgaagatcaagatcatcgcgccccctgagcgcaagtactccgtgtgg
attggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system