KEGG   Capra hircus (goat): 100860901
Entry
100860901         CDS       T02910                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04520  Adherens junction
chx04916  Melanogenesis
chx04934  Cushing syndrome
chx05132  Salmonella infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100860901 (LEF1)
   04390 Hippo signaling pathway
    100860901 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100860901 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100860901 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860901 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100860901 (LEF1)
   05225 Hepatocellular carcinoma
    100860901 (LEF1)
   05226 Gastric cancer
    100860901 (LEF1)
   05216 Thyroid cancer
    100860901 (LEF1)
   05221 Acute myeloid leukemia
    100860901 (LEF1)
   05217 Basal cell carcinoma
    100860901 (LEF1)
   05215 Prostate cancer
    100860901 (LEF1)
   05213 Endometrial cancer
    100860901 (LEF1)
   05224 Breast cancer
    100860901 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100860901 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100860901 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860901 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860901 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    100860901 (LEF1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100860901 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100860901
NCBI-ProteinID: NP_001272675
UniProt: D7RGY6
LinkDB
Position
4
AA seq 371 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYSKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPYTTGIPHPAIVTPQV
KQEHPHNDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESAS
GTGPRMTAAYI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggagaagatcttcgccgag
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggttaacgaa
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gagtcataccatgacaaggccagagaacatcctgatgatggaaagcatccagatggaggt
ctctacagtaagggaccctcttattcgagttattctggatacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttcgccacccatcccaagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccctctcatcacgtac
agcgacgagcacttttctccaggatcacacccgtcacatatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcccgagatccctacgttttatcccctgtct
ccaggtggtgttggacagataaccccacctcttggctggttttctcatcatatgattcct
ggtcctcctggtccctacacaactggcatccctcatccagccatcgtaacgcctcaggtc
aaacaggaacacccccacaatgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaaaaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgtagctgagtgtactctaaaggaaagtgcagct
atcaaccagattctaggcagaaggtggcatgccctctctcgtgaagagcaggctaaatat
tatgaattagcgcggaaggaaagacagctacatatgcagctctatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaagctacaggagtccgcatca
ggtacaggtccaagaatgacagctgcctacatctga

KEGG   Capra hircus (goat): 102173736
Entry
102173736         CDS       T02910                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04520  Adherens junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04916  Melanogenesis
chx04934  Cushing syndrome
chx05132  Salmonella infection
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102173736 (TCF7)
   04390 Hippo signaling pathway
    102173736 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102173736 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    102173736 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102173736 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102173736 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102173736 (TCF7)
   05225 Hepatocellular carcinoma
    102173736 (TCF7)
   05226 Gastric cancer
    102173736 (TCF7)
   05216 Thyroid cancer
    102173736 (TCF7)
   05221 Acute myeloid leukemia
    102173736 (TCF7)
   05217 Basal cell carcinoma
    102173736 (TCF7)
   05215 Prostate cancer
    102173736 (TCF7)
   05213 Endometrial cancer
    102173736 (TCF7)
   05224 Breast cancer
    102173736 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102173736 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102173736 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102173736 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102173736 (TCF7)
   05165 Human papillomavirus infection
    102173736 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102173736 (TCF7)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102173736 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102173736
NCBI-ProteinID: XP_017905877
UniProt: A0A452GAV5
LinkDB
Position
7
AA seq 418 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAASDAGVPGAGAGARGEAEVGAEALGRAHTSQRLFPDKLPESLEDGLKAPECTSGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLNKASQPSHGVPQLSPLYDHFSSPHPTPVPADI
SQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAP
GAPYPRFTHPPLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRSLKAQADSKAEKEAKK
PTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKER
QLHMQLYPGWSARDNYGKKKRRSREKHQESNSGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggtggcgcgggcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggctgagctcaagtcgtcgctcgtcaatgagtccgag
ggcgcggccagcgacgcgggggtcccgggggcgggcgccggtgcccgcggcgaggccgag
gtcggggcggaggctctcgggcgggcacacacttcgcagagacttttccccgacaaactt
ccagagtctctggaagacggcctgaaggccccggagtgcaccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactacccgcccccctcgggagcagggcag
cacccccagccgcagcccccgctgaacaaggccagtcagccttcccatggcgtcccccaa
ctttctcctctctatgaccatttcagcagcccacaccccacacctgtaccagctgacatc
agccagaagcaaggagttcacaggcctctgcagacccctgacctctctggcttctactct
ctgacctcaggcagcatgggacagctcccccacactgtgagctggcccagccctcctctc
taccccctgtccccttcctgcggatatagacagcacttccctgcccccaccgcagcccct
ggcgccccctaccccaggttcacccatccacccctgatgctaggttctggtgtccctggt
caccccgcagccatcccccacccagccatcgtaccctcttcagggaagcaggagctgcag
ccctatgaccgcagcctgaaagctcaagcagactctaaggcagagaaggaagccaagaag
ccgaccatcaagaagcccctcaacgccttcatgctatacatgaaggagatgagagccaaa
gtcattgcggaatgcacgctcaaggagagtgctgccatcaaccagatcctgggccgtcgg
tggcacgcactgtcccgggaagagcaggccaagtattatgagctggcccgcaaggagagg
cagctgcacatgcagctatacccaggctggtcggcgcgggacaactacgggaagaagaag
agacggtcgagggaaaagcaccaagaatccaactcaggaggaaaaagaaatgcattcggt
acttacccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

KEGG   Capra hircus (goat): 102180102
Entry
102180102         CDS       T02910                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04520  Adherens junction
chx04916  Melanogenesis
chx04934  Cushing syndrome
chx05132  Salmonella infection
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102180102 (TCF7L2)
   04390 Hippo signaling pathway
    102180102 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102180102 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102180102 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180102 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102180102 (TCF7L2)
   05225 Hepatocellular carcinoma
    102180102 (TCF7L2)
   05226 Gastric cancer
    102180102 (TCF7L2)
   05216 Thyroid cancer
    102180102 (TCF7L2)
   05221 Acute myeloid leukemia
    102180102 (TCF7L2)
   05217 Basal cell carcinoma
    102180102 (TCF7L2)
   05215 Prostate cancer
    102180102 (TCF7L2)
   05213 Endometrial cancer
    102180102 (TCF7L2)
   05224 Breast cancer
    102180102 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102180102 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102180102 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102180102 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180102 (TCF7L2)
   05165 Human papillomavirus infection
    102180102 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102180102 (TCF7L2)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102180102 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102180102
NCBI-ProteinID: XP_017896695
LinkDB
Position
26
AA seq 674 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLS
MMPPPPALLLAEAAHGKAPALCANGALDLPPAALQPPAIPPASLAQPSTSSLHSHGALAG
TQPQPLSLVTKSLE
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcggagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaactctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgctcgctctccgtcgcca
gcccacatcgttcagtgccccctcccttgctgcactcagggacatgactgtcagcacttc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccac
tccttacaaaaggttggggagccctggtgtttggagtcgaacaaagtgccggttgtgcag
cacccgcatcatgtccaccctctcacgcctcttatcacatacagcaatgaacacttcacg
ccgggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatctccgtactacccgctgtcacctggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagccagtgtaccccatcacg
acaggaggattccgtcacccctaccccacagctctgactgtcaacgcttccatgtccagc
tttctgtcttccaggttccctccccatatggtcccaccacatcacactctgcacacgact
ggcattccccacccggccatagtcacgccgacagtcaaacaggagtcctcgcagagtgac
gtcggctcactccacagcgcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaatgcattcatgttgtatatgaaggaaatgagagcaaag
gttgtagctgagtgcacgttgaaagaaagtgcagccatcaaccagatcctgggccggagg
tggcacgcgctgtccagagaagagcaagcaaagtactacgagctggcccggaaggagcga
cagcttcacatgcagctgtaccccggctggtccgcacgggataactatgggaaaaagaag
aagaggaaaagggacaagcagcccggggagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgcctccttcctcccccaacctgctaggctccccaccccaggacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccctggcccacctgtcc
atgatgcctccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcccccgcc
ctctgtgccaacggggccctggacctgccccccgccgctctgcagccgcctgccatcccc
cccgcatctctggcacagccgtcgacatcttccttacattcccacggcgctctggccggg
acccagccccagccgctgtccctcgtcaccaagtctttagaatag

KEGG   Capra hircus (goat): 102187776
Entry
102187776         CDS       T02910                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04520  Adherens junction
chx04916  Melanogenesis
chx04934  Cushing syndrome
chx05132  Salmonella infection
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102187776 (TCF7L1)
   04390 Hippo signaling pathway
    102187776 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102187776 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102187776 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102187776 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102187776 (TCF7L1)
   05225 Hepatocellular carcinoma
    102187776 (TCF7L1)
   05226 Gastric cancer
    102187776 (TCF7L1)
   05216 Thyroid cancer
    102187776 (TCF7L1)
   05221 Acute myeloid leukemia
    102187776 (TCF7L1)
   05217 Basal cell carcinoma
    102187776 (TCF7L1)
   05215 Prostate cancer
    102187776 (TCF7L1)
   05213 Endometrial cancer
    102187776 (TCF7L1)
   05224 Breast cancer
    102187776 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102187776 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102187776 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102187776 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102187776 (TCF7L1)
   05165 Human papillomavirus infection
    102187776 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102187776 (TCF7L1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102187776 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102187776
NCBI-ProteinID: XP_017910876
UniProt: A0A452E532
LinkDB
Position
11
AA seq 587 aa
MPQLGGGGGGGSGGGSGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGY
PFLMIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPASTTVKDARSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVG
QIPHPLSWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPT
SGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRA
KVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKK
KKRKREKQLSQTQSQQQQVQEADGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPAT
PSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSSKAAATSSGQMGSQPPL
LSRPLPLGSVPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcggcggctcgggaggcggcagcggcggctcgggg
gccggggcagcaggcggaggggacgacctcggggccaacgacgagctgatccccttccag
gacgagggaggcgaggagcaggagccgagcagcgacagcgcgtcggcgcagcgggacctg
gacgaagtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcg
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccacgggactatttt
gccgaagtgagaaggccccaggacggcgcgttctttaaggggcccccctaccctggctac
ccattcctgatgatcccggacctgagcagcccgtacctccccaacggacccctgtctccc
ggaggagcgcgcacgtacctgcagatgaaatggccactcctcgatgtccccgccagcacc
acagtcaaggacgccaggtcaccgtccccagcacacttgtctaataaagttcctgttgtt
cagcacccgcaccacatgcatccgttgacacccctcatcacctacagcaacgaccacttc
tcccccggctcccctcccacacacctctccccagagatcgatccaaagacaggaatcccc
cggccccctcatccatccgagctgtctccgtattacccactgtctcccggagctgttggg
caaatcccacatcccctcagctggctcgtcccacagcaaggacagcccatgtactccctt
cctcccggtggcttcaggcacccctaccctgccctcgccatgaatgcctcgatgtccagc
ctggtttccagtcggttctcccctcacatggtggctccggcccatcctggtctgcccacc
tcagggatcccccaccccgccattgtctcccccattgtcaagcaggaaccagcgccccct
agcctgagcccagctgtgagcgcgaaatcaccagtcacagtgaagaaagaggaagaaaag
aagccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagggcg
aaggtggtggctgagtgcaccctgaaggagagtgcagccatcaaccagatcctgggaagg
aagtggcacaacctgtcccgagaagaacaggccaagtactacgaattggcccggaaggag
cggcagcttcactcacagctctacccaacctggtcagcccgggacaactacggtaagaaa
aagaagaggaagcgagaaaagcagctgtcccaaacacagtcccagcagcagcaagtccag
gaggcagatggtgctctggcctccaaaagcaagaagccatgtgtccagtacctgcccccc
gagaagccctgtgacagccctgcttcctcccacggcagcatgctggactccccagctacc
ccctccgcggccttggcctccccggccgccccagccgccacccactcggagcaagcccag
cccctctccctcaccaccaagccagagacccgggcccagctggctctccactcagccgcc
ttcctgtcatcaaaggctgccgccacctcttctggccagatgggcagccagcccccgctc
ctgtcccggcccctacctttggggtctgtgcccacagctctgctgacgtcccccccatcc
ttccccgccacgctccacgcccaccaggccctccccgtgctccaggcccagcctctgtcc
ttggtcaccaagtctgcccactaa

DBGET integrated database retrieval system