KEGG   Capra hircus (goat): 100860902
Entry
100860902         CDS       T02910                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04072  Phospholipase D signaling pathway
chx04136  Autophagy - other
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04371  Apelin signaling pathway
chx04613  Neutrophil extracellular trap formation
chx04630  JAK-STAT signaling pathway
chx04659  Th17 cell differentiation
chx04714  Thermogenesis
chx04910  Insulin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04920  Adipocytokine signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100860902 (MTOR)
   04371 Apelin signaling pathway
    100860902 (MTOR)
   04630 JAK-STAT signaling pathway
    100860902 (MTOR)
   04066 HIF-1 signaling pathway
    100860902 (MTOR)
   04072 Phospholipase D signaling pathway
    100860902 (MTOR)
   04151 PI3K-Akt signaling pathway
    100860902 (MTOR)
   04152 AMPK signaling pathway
    100860902 (MTOR)
   04150 mTOR signaling pathway
    100860902 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100860902 (MTOR)
   04136 Autophagy - other
    100860902 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100860902 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100860902 (MTOR)
   04659 Th17 cell differentiation
    100860902 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100860902 (MTOR)
   04920 Adipocytokine signaling pathway
    100860902 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100860902 (MTOR)
   04919 Thyroid hormone signaling pathway
    100860902 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100860902 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100860902 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100860902 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860902 (MTOR)
   05206 MicroRNAs in cancer
    100860902 (MTOR)
   05205 Proteoglycans in cancer
    100860902 (MTOR)
   05230 Central carbon metabolism in cancer
    100860902 (MTOR)
   05231 Choline metabolism in cancer
    100860902 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100860902 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100860902 (MTOR)
   05212 Pancreatic cancer
    100860902 (MTOR)
   05225 Hepatocellular carcinoma
    100860902 (MTOR)
   05226 Gastric cancer
    100860902 (MTOR)
   05214 Glioma
    100860902 (MTOR)
   05221 Acute myeloid leukemia
    100860902 (MTOR)
   05215 Prostate cancer
    100860902 (MTOR)
   05224 Breast cancer
    100860902 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100860902 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100860902 (MTOR)
   05016 Huntington disease
    100860902 (MTOR)
   05017 Spinocerebellar ataxia
    100860902 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100860902 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100860902 (MTOR)
   04931 Insulin resistance
    100860902 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100860902 (MTOR)
   05168 Herpes simplex virus 1 infection
    100860902 (MTOR)
   05163 Human cytomegalovirus infection
    100860902 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860902 (MTOR)
   05165 Human papillomavirus infection
    100860902 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100860902 (MTOR)
   01522 Endocrine resistance
    100860902 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100860902 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    100860902 (MTOR)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100860902 (MTOR)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100860902 (MTOR)
Membrane trafficking [BR:chx04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100860902 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 Adaptin_N V-ATPase_H_N UME HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100860902
NCBI-ProteinID: NP_001272677
UniProt: D9I5T4
LinkDB
Position
16
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKEPQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGDATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMLKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREGMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQLSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMPSLVLMHKPLQHPGMPKGLAHQLASPGLTTPPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEATRTCSRLLTPSVHLISGHAHVVSQTAVRVVADVLSKLL
VVGITDPDPDIRYCVLASLNERFDAHLAQAENLQALFVALNDQVFETRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELTQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSGSKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLVYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWALGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLD
VPTQVELLIKQATSHENLCQCYLGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgccgccgccaccacggctgccaccacatccagcaacgtgagc
gtcctgcagcagtttgccagcggcctaaagagccggaatgaagagaccagggccaaagct
gccaaggagccccagcactacgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgatcagttgaaccatcacatctttgaactggtgtccagctcagatgcc
aatgagaggaaaggtggcattttggccatagccagcctcataggagttgaaggtggggat
gccactcggatcggaagatttgctaactaccttcggaacctccttccctccaatgaccca
gttgtcatggagatggcatccaaggccatcggtcggctcgccatggcaggggacactttc
actgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aacgagggccgaagacacgcggctgtcctggtgctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaatatctttgtggctgtgtgggac
cccaaacaggccatccgggagggagctgtcgccgcccttcgtgcctgtctgatcctcacc
acccagcgggagccaaaagagatgctgaagccgcagtggtacaggcacacgtttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggatgaccgg
atccatggagccctgctgattctcaacgagctggtccggatcagcagcatggagggagag
cgcctgagagaaggaatggaagaaatcacacagcagcagttggtccatgacaagtactgc
aaggatctcatgggttttggaacgaaaccccgtcacatcaccccattcaccagtttccag
gccgtgcagccccagctgtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggcttcgggacctcccccagcccggcaaagtccacgctggtggagagtcgc
tgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtcctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctgagctgcgtcaagaaggagaaggaacggacagcagcctttcaagccctggggctactt
tctgtggctgtgaggtctgagttcaaggtctatttacctcgtgtgctggacattatccga
gcagccctgccccctaaggacttcgcccataagagacagaaggctatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgagccatggggccaggcatccaacaggac
atcaaggagctgctggagcccatgctggcagtgggcctgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagatgggctgctg
aagatgccgtccctggtccttatgcacaaacccctccagcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacgaccccccctgaggccagtgatgtgggc
agcatcacccttgctctccgaactctcggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgtatg
gaggccacccgcacctgctcccgcctgctcacgccctctgtccacctcatcagtggccac
gctcatgtggtcagccagactgcagtgcgagtggtggcagatgtgctcagcaaactgctt
gtggttgggataactgatcctgaccccgacatccgctactgtgtcttggcgtccctgaac
gagcgctttgatgcacacctggcccaggcagagaacctgcaggccctgttcgtggctctg
aatgaccaggtgtttgagacccgggagctggctatctgcactgtgggccggctcagcagc
atgaacccagcctttgtcatgcctttcctgcgcaagatgctcatccagattctgacagag
ctggagcacagcggcattggaagaatcaaggagcagagtgcccgaatgctgggtcacctg
gtctccaacgccccacgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttgactcaggttagtggcctcgaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaagactcctctctgttggccaaaaggcaggtggct
ctgtggaccctggggcagttggtggccagcaccggctacgtggtcgagccctacaggaag
taccccacgttgctggaggtgctgctgaactttctgaagactgagcagaaccagggtaca
cggcgggaggctatccgtgtgttggggcttctaggggcactggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgggatgcttctgccgtcagcctgtcagggtcc
aagtcaagtcaagactcttctgactatagcaccagcgagatgctggtcaacatggggaac
ctgcctctagacgagttctacccggccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccaccacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgcgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgagatagtcacgctcatgagagaa
ttctgggtcatgaacacctccatccagagcacaatcattctcctcattgagcagattgtg
gtagccctcgggggtgaatttaagctctacctgccccagctgattccacacatgcttcgt
gtcttcatgcatgacaatagctcaggccgcatcgtctccatcaagttgctggctgcaatc
cagctgttcggtgccaacctggacgactatctgcatttgttgctgcccccgatcgtgaag
ttatttgatgcccccgaagccccattgccttctcgaaaggccgcgctagagaccgtggac
cgtctgacggagtctctggatttcacggactatgcctctcggatcattcatccgattgta
cgcacactggaccagagcccagaactccgttccacagcaatggacacattgtcttcactc
gtctttcagctgggaaagaagtaccaaattttcattccaatggtgaacaaagttctggtg
agacaccgaatcaaccatcagcgctacgacgtcctcatctgcaggatagtcaaggggtat
accctagctgacgaggaggaggaccctctggtttaccagcatcgaatgctgaggagcggc
caaggtgatgccttagccagtggaccagtggaaacggggcccatgaagaagctgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtttccaaagatgattgg
ttggaatggctgcggcggctgagcctggagctactgaaggactcctcgtcaccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaatgct
gcatttgtgtcctgctggtctgagctgaatgaggaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgcagaagtcacgcaaaccctcttaaatttg
gctgaattcatggaacacagtgacaagggccccctgcctttgagagatgacaatggcatt
gtcctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccccgccatcctcgagtctctcatcagcattaat
aataagctgcagcagccagaggcagctgctggggtgttggagtatgccatgaagcacttt
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaagatgctctc
gtggcctatgataagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagcttcaccagcagtgctgtgaaaaa
tggactctggttaatgatgagacccaagccaagatggcccgcatggctgccgcagctgca
tgggctttaggtcagtgggacagcatggaagagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcactacatcaggacctcttctccttggca
caacagtgcatcgacaaagcccgggacctactggatgcagagttaacagcaatggcagga
gagagctacagccgggcctatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcactcgtcgtcagccctcatgaggacatgagaacttggctcaagtacgcaagcctgtgt
ggcaagagtggcaggctggcgcttgctcacaaaaccttagtgctactcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgcccgcaagattgacgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcatgccattgccaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaactcggggagtggcagctaaac
ctacagggcatcaacgagagcacgatccccaaagtcctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcatgggcagtgatgaactttgaggct
gtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaagctgcgacatgcc
agtggggccaacatcactaacgcggccactgctgccaccacagcggccaccgccaccgcc
accgccagcactgagggcagcaatagcgagagtgaggctgagagcaccgagaacagccct
accccgtctcctctgcagaagaaggtcactgaggatttgtctaaaaccctcttgatgtac
actgtcccggctgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggacacgctcagagttctcaccttatggtttgattatggtcactggccagatgtaaat
gaagccttagtggaaggggtgaaagcaatccagattgacacttggttacaggttatacct
cagctcatcgcaagaattgatacgccgaggcccctggtgggacgtcttatccaccagctt
ctcacagatattggtcggtaccacccccaggccctcatctacccgctgacagtggcctcc
aagtccaccaccacggcccggcacaacgcagccaacaaaatcctgaagaacatgtgcgaa
cacagcaacacgctggtgcagcaggccatgatggtgagtgaggagctgatccgagtggcc
atcctctggcacgagatgtggcatgaaggcctggaagaggcatctcgcttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcacgccatgatggagcgg
ggaccccagacactgaaggaaacatcatttaaccaggcatatggtcgagatttaatggag
gcccaggaatggtgcaggaagtacatgaaatcagggaacgtcaaggacctcacccaagcc
tgggacctctattaccatgtattcagacgaatctccaagcagctgcctcagctcacatcc
ttagagttgcagtacgtctcccctaaacttctgatgtgccgggatctggaactggctgtg
ccgggaacttatgaccccaaccagcccatcattcgcattcaatccattgcgccgtctctg
caagtcatcacatccaagcagaggccccggaagttgacgcttatgggcagcaacgggcat
gagtttgtcttcctcctgaagggccatgaggacctgcggcaggacgaacgggtgatgcag
ctctttggcctggtcaacacccttctggccaatgacccaacgtctcttcggaaaaacctc
agcatccagagatacgctgtcattccattatcaaccaactcgggcctcatcggctgggtg
ccccactgtgacacgctgcacgccctcatccgggactacagggagaaaaagaagatcctt
ctcaacattgagcatcgcatcatgctgcggatggctccggactatgaccatctaactctg
atgcagaaggtcgaggtgtttgagcatgctgtcaacaacacagctggggatgacctggct
aaactgctgtggctgaagagccccagctctgaggtgtggtttgatcgaagaaccaattat
acccgctctttagcggtcatgtctatggttgggtatattttgggcctgggcgatagacat
ccatccaacctgatgctggaccggctgagtggaaagattctgcacattgactttggggac
tgctttgaggttgctatgaccagagagaaattcccagagaagattccatttagactaacg
agaatgctgaccaatgctatggaggtcacgggccttgatggcaactacaggatcacgtgc
cacaccgtgatggaggtgctccgggagcacaaggacagcgtcatggccgtgctggaagcc
ttcgtctatgaccccctgctgaactggaggctgatggacacaaataccaaaggtaacaag
cgatcacggacgaggaccgattcctactctgctggccagtcagtagaaattttggatggt
gtggaacttggggaaccagcccataagaaaacggggaccacggtgccagaatctattcat
tctttcattggagatggtttggtgaaaccagaggccctaaataagaaagctattcaaatt
attaacagggttcgagataaactcactggtcgggacttctctcatgacgaaaccctggat
gtcccaacacaagtcgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctaccttggctggtgtcctttctggtaa

DBGET integrated database retrieval system