KEGG   Capra hircus (goat): 100860904
Entry
100860904         CDS       T02910                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04728  Dopaminergic synapse
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04920  Adipocytokine signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100860904 (AKT1)
   04012 ErbB signaling pathway
    100860904 (AKT1)
   04014 Ras signaling pathway
    100860904 (AKT1)
   04015 Rap1 signaling pathway
    100860904 (AKT1)
   04370 VEGF signaling pathway
    100860904 (AKT1)
   04371 Apelin signaling pathway
    100860904 (AKT1)
   04630 JAK-STAT signaling pathway
    100860904 (AKT1)
   04668 TNF signaling pathway
    100860904 (AKT1)
   04066 HIF-1 signaling pathway
    100860904 (AKT1)
   04068 FoxO signaling pathway
    100860904 (AKT1)
   04072 Phospholipase D signaling pathway
    100860904 (AKT1)
   04071 Sphingolipid signaling pathway
    100860904 (AKT1)
   04024 cAMP signaling pathway
    100860904 (AKT1)
   04022 cGMP-PKG signaling pathway
    100860904 (AKT1)
   04151 PI3K-Akt signaling pathway
    100860904 (AKT1)
   04152 AMPK signaling pathway
    100860904 (AKT1)
   04150 mTOR signaling pathway
    100860904 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100860904 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100860904 (AKT1)
   04218 Cellular senescence
    100860904 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100860904 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100860904 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100860904 (AKT1)
   04613 Neutrophil extracellular trap formation
    100860904 (AKT1)
   04620 Toll-like receptor signaling pathway
    100860904 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100860904 (AKT1)
   04660 T cell receptor signaling pathway
    100860904 (AKT1)
   04662 B cell receptor signaling pathway
    100860904 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100860904 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100860904 (AKT1)
   04062 Chemokine signaling pathway
    100860904 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100860904 (AKT1)
   04922 Glucagon signaling pathway
    100860904 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100860904 (AKT1)
   04920 Adipocytokine signaling pathway
    100860904 (AKT1)
   04929 GnRH secretion
    100860904 (AKT1)
   04915 Estrogen signaling pathway
    100860904 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100860904 (AKT1)
   04917 Prolactin signaling pathway
    100860904 (AKT1)
   04926 Relaxin signaling pathway
    100860904 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100860904 (AKT1)
   04919 Thyroid hormone signaling pathway
    100860904 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100860904 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100860904 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100860904 (AKT1)
   04728 Dopaminergic synapse
    100860904 (AKT1)
   04722 Neurotrophin signaling pathway
    100860904 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100860904 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100860904 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100860904 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860904 (AKT1)
   05205 Proteoglycans in cancer
    100860904 (AKT1)
   05230 Central carbon metabolism in cancer
    100860904 (AKT1)
   05231 Choline metabolism in cancer
    100860904 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100860904 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100860904 (AKT1)
   05212 Pancreatic cancer
    100860904 (AKT1)
   05225 Hepatocellular carcinoma
    100860904 (AKT1)
   05226 Gastric cancer
    100860904 (AKT1)
   05214 Glioma
    100860904 (AKT1)
   05221 Acute myeloid leukemia
    100860904 (AKT1)
   05220 Chronic myeloid leukemia
    100860904 (AKT1)
   05218 Melanoma
    100860904 (AKT1)
   05211 Renal cell carcinoma
    100860904 (AKT1)
   05215 Prostate cancer
    100860904 (AKT1)
   05213 Endometrial cancer
    100860904 (AKT1)
   05224 Breast cancer
    100860904 (AKT1)
   05222 Small cell lung cancer
    100860904 (AKT1)
   05223 Non-small cell lung cancer
    100860904 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100860904 (AKT1)
   05017 Spinocerebellar ataxia
    100860904 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100860904 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100860904 (AKT1)
   04931 Insulin resistance
    100860904 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100860904 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860904 (AKT1)
   05135 Yersinia infection
    100860904 (AKT1)
   05152 Tuberculosis
    100860904 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100860904 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100860904 (AKT1)
   05161 Hepatitis B
    100860904 (AKT1)
   05160 Hepatitis C
    100860904 (AKT1)
   05164 Influenza A
    100860904 (AKT1)
   05162 Measles
    100860904 (AKT1)
   05168 Herpes simplex virus 1 infection
    100860904 (AKT1)
   05163 Human cytomegalovirus infection
    100860904 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860904 (AKT1)
   05169 Epstein-Barr virus infection
    100860904 (AKT1)
   05165 Human papillomavirus infection
    100860904 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100860904 (AKT1)
   05142 Chagas disease
    100860904 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100860904 (AKT1)
   01524 Platinum drug resistance
    100860904 (AKT1)
   01522 Endocrine resistance
    100860904 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100860904 (AKT1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100860904 (AKT1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100860904 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100860904
NCBI-ProteinID: NP_001272679
UniProt: D9IA52
LinkDB
Position
21
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDLEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPGENSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVIPVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELLFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYQKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSERRPHFPQFSYSASATA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaagcgaggggagtacatcaag
acctggcggccgcgttacttcctcctgaagagcgatggcaccttcatcggctacaaggag
cggccgcaggacctggagcagcgcgagtcgcccctcaacaacttctctgtggcccaatgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcacgttccacgtggagacgcccgaggagcgggaggagtggacc
accgccatccagacggtggccgatgggctcaagaggcaggaggaggagacgatggacttc
cggtcgggctcgcctggcgagaactcgggggccgaggagatggaggtgtcgctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcccggtgaaggagaaggccacaggccgctactacgccatgaaaatc
ctgaagaaggaggtcatcgtggccaaagacgaggtggcccacacgctcacagagaaccgc
gttctccagaactcccggcacccgttcctgacggccctgaagtactccttccagacacac
gaccgcctgtgcttcgtcatggagtacgccaacgggggcgagctcctcttccacctgtcc
cgggagcgggtgtttccggaggaccgggcccgcttctacggcgccgagatcgtgtcggcc
ctggattacctgcactcggagaagaacgtggtgtacagggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcaccgactttgggctgtgcaaggagggcatc
aaggacggcgccaccatgaagactttctgcgggacccccgagtacctggcccccgaggtg
ctggaagacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggagatccgcttcccgcgcacactcagcccggaggccaagtccttgctc
tcggggctgctcaagaaggaccctaagcagcggcttggtgggggctctgaggacgccaag
gagatcatgcagcaccgattcttcgccagcatcgtgtggcaggacgtgtaccagaagaag
ctcagcccgcccttcaagcctcaggtcacgtctgagacagacaccaggtattttgatgag
gagttcacagcccagatgatcaccattacgccacctgaccaagacgacagcatggagggg
gtggacagcgagcggaggccccacttcccccagttctcctactcggccagcgccacggcc
tga

KEGG   Capra hircus (goat): 102174051
Entry
102174051         CDS       T02910                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04728  Dopaminergic synapse
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04920  Adipocytokine signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102174051 (AKT3)
   04012 ErbB signaling pathway
    102174051 (AKT3)
   04014 Ras signaling pathway
    102174051 (AKT3)
   04015 Rap1 signaling pathway
    102174051 (AKT3)
   04370 VEGF signaling pathway
    102174051 (AKT3)
   04371 Apelin signaling pathway
    102174051 (AKT3)
   04630 JAK-STAT signaling pathway
    102174051 (AKT3)
   04668 TNF signaling pathway
    102174051 (AKT3)
   04066 HIF-1 signaling pathway
    102174051 (AKT3)
   04068 FoxO signaling pathway
    102174051 (AKT3)
   04072 Phospholipase D signaling pathway
    102174051 (AKT3)
   04071 Sphingolipid signaling pathway
    102174051 (AKT3)
   04024 cAMP signaling pathway
    102174051 (AKT3)
   04022 cGMP-PKG signaling pathway
    102174051 (AKT3)
   04151 PI3K-Akt signaling pathway
    102174051 (AKT3)
   04152 AMPK signaling pathway
    102174051 (AKT3)
   04150 mTOR signaling pathway
    102174051 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102174051 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102174051 (AKT3)
   04218 Cellular senescence
    102174051 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102174051 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102174051 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102174051 (AKT3)
   04613 Neutrophil extracellular trap formation
    102174051 (AKT3)
   04620 Toll-like receptor signaling pathway
    102174051 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102174051 (AKT3)
   04660 T cell receptor signaling pathway
    102174051 (AKT3)
   04662 B cell receptor signaling pathway
    102174051 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102174051 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102174051 (AKT3)
   04062 Chemokine signaling pathway
    102174051 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102174051 (AKT3)
   04922 Glucagon signaling pathway
    102174051 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102174051 (AKT3)
   04920 Adipocytokine signaling pathway
    102174051 (AKT3)
   04929 GnRH secretion
    102174051 (AKT3)
   04915 Estrogen signaling pathway
    102174051 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102174051 (AKT3)
   04917 Prolactin signaling pathway
    102174051 (AKT3)
   04926 Relaxin signaling pathway
    102174051 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102174051 (AKT3)
   04919 Thyroid hormone signaling pathway
    102174051 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102174051 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102174051 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102174051 (AKT3)
   04728 Dopaminergic synapse
    102174051 (AKT3)
   04722 Neurotrophin signaling pathway
    102174051 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102174051 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102174051 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102174051 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174051 (AKT3)
   05205 Proteoglycans in cancer
    102174051 (AKT3)
   05230 Central carbon metabolism in cancer
    102174051 (AKT3)
   05231 Choline metabolism in cancer
    102174051 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102174051 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102174051 (AKT3)
   05212 Pancreatic cancer
    102174051 (AKT3)
   05225 Hepatocellular carcinoma
    102174051 (AKT3)
   05226 Gastric cancer
    102174051 (AKT3)
   05214 Glioma
    102174051 (AKT3)
   05221 Acute myeloid leukemia
    102174051 (AKT3)
   05220 Chronic myeloid leukemia
    102174051 (AKT3)
   05218 Melanoma
    102174051 (AKT3)
   05211 Renal cell carcinoma
    102174051 (AKT3)
   05215 Prostate cancer
    102174051 (AKT3)
   05213 Endometrial cancer
    102174051 (AKT3)
   05224 Breast cancer
    102174051 (AKT3)
   05222 Small cell lung cancer
    102174051 (AKT3)
   05223 Non-small cell lung cancer
    102174051 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102174051 (AKT3)
   05017 Spinocerebellar ataxia
    102174051 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102174051 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102174051 (AKT3)
   04931 Insulin resistance
    102174051 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102174051 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102174051 (AKT3)
   05135 Yersinia infection
    102174051 (AKT3)
   05152 Tuberculosis
    102174051 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102174051 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102174051 (AKT3)
   05161 Hepatitis B
    102174051 (AKT3)
   05160 Hepatitis C
    102174051 (AKT3)
   05164 Influenza A
    102174051 (AKT3)
   05162 Measles
    102174051 (AKT3)
   05168 Herpes simplex virus 1 infection
    102174051 (AKT3)
   05163 Human cytomegalovirus infection
    102174051 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102174051 (AKT3)
   05169 Epstein-Barr virus infection
    102174051 (AKT3)
   05165 Human papillomavirus infection
    102174051 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102174051 (AKT3)
   05142 Chagas disease
    102174051 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102174051 (AKT3)
   01524 Platinum drug resistance
    102174051 (AKT3)
   01522 Endocrine resistance
    102174051 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102174051 (AKT3)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102174051 (AKT3)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102174051 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 102174051
NCBI-ProteinID: XP_017915748
UniProt: A0A452G1K3
LinkDB
Position
16
AA seq 481 aa
MSEKKYVSEKIAGKYAKGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAK
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMN
CSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKI
LKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLS
RERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
DAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELI
LMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKL
VPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtcggagaaaaaatatgtatcggaaaagattgcaggaaaatatgccaaaggagaatat
ataaaaaactggaggccaagatatttccttttgaagacagatggctcattcataggatat
aaagagaaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaa
tgccagttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccag
tggaccactgtcatagagagaacatttcacgtagatactccagaggaaagggaagaatgg
acagaagctatccaggctgtagcagacagactccagaggcaagaagaagagagaatgaat
tgtagtccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacc
catcataagagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcact
tttgggaaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagatt
ctgaagaaagaagttattattgccaaggatgaagtggcacacactttaactgaaagcaga
gtattaaagaacactagacatccctttttaacatccctgaaatattccttccagacaaaa
gaccgtttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcg
agagagcgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgcc
ttggactatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatg
ctggataaagatggccacataaaaatcacagattttggactttgcaaagaagggatcact
gatgcagccaccatgaagactttctgtggtacaccagagtatctggcaccagaggtgtta
gaagataatgactatggccgagctgtggattggtggggccttggggttgtcatgtatgaa
atgatgtgtgggagattacctttctataaccaggatcatgagaaactttttgaactaatt
ctaatggaagatattaaatttcctcgaacactctcttcagatgcaaaatcattgctttca
gggctcttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaa
attatgagacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagctt
gtacctccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaa
tttacagctcagactattacaataacaccacctgaaaaatatgatgaggacggtatggac
tgcatggacaatgagaggcggccgcacttccctcaattttcctactctgcaagtggacga
gaataa

KEGG   Capra hircus (goat): 102187521
Entry
102187521         CDS       T02910                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04728  Dopaminergic synapse
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04920  Adipocytokine signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102187521 (AKT2)
   04012 ErbB signaling pathway
    102187521 (AKT2)
   04014 Ras signaling pathway
    102187521 (AKT2)
   04015 Rap1 signaling pathway
    102187521 (AKT2)
   04370 VEGF signaling pathway
    102187521 (AKT2)
   04371 Apelin signaling pathway
    102187521 (AKT2)
   04630 JAK-STAT signaling pathway
    102187521 (AKT2)
   04668 TNF signaling pathway
    102187521 (AKT2)
   04066 HIF-1 signaling pathway
    102187521 (AKT2)
   04068 FoxO signaling pathway
    102187521 (AKT2)
   04072 Phospholipase D signaling pathway
    102187521 (AKT2)
   04071 Sphingolipid signaling pathway
    102187521 (AKT2)
   04024 cAMP signaling pathway
    102187521 (AKT2)
   04022 cGMP-PKG signaling pathway
    102187521 (AKT2)
   04151 PI3K-Akt signaling pathway
    102187521 (AKT2)
   04152 AMPK signaling pathway
    102187521 (AKT2)
   04150 mTOR signaling pathway
    102187521 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102187521 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102187521 (AKT2)
   04218 Cellular senescence
    102187521 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102187521 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102187521 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102187521 (AKT2)
   04613 Neutrophil extracellular trap formation
    102187521 (AKT2)
   04620 Toll-like receptor signaling pathway
    102187521 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102187521 (AKT2)
   04660 T cell receptor signaling pathway
    102187521 (AKT2)
   04662 B cell receptor signaling pathway
    102187521 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102187521 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102187521 (AKT2)
   04062 Chemokine signaling pathway
    102187521 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102187521 (AKT2)
   04922 Glucagon signaling pathway
    102187521 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102187521 (AKT2)
   04920 Adipocytokine signaling pathway
    102187521 (AKT2)
   04929 GnRH secretion
    102187521 (AKT2)
   04915 Estrogen signaling pathway
    102187521 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102187521 (AKT2)
   04917 Prolactin signaling pathway
    102187521 (AKT2)
   04926 Relaxin signaling pathway
    102187521 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102187521 (AKT2)
   04919 Thyroid hormone signaling pathway
    102187521 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102187521 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102187521 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102187521 (AKT2)
   04728 Dopaminergic synapse
    102187521 (AKT2)
   04722 Neurotrophin signaling pathway
    102187521 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102187521 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102187521 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102187521 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102187521 (AKT2)
   05205 Proteoglycans in cancer
    102187521 (AKT2)
   05230 Central carbon metabolism in cancer
    102187521 (AKT2)
   05231 Choline metabolism in cancer
    102187521 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102187521 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102187521 (AKT2)
   05212 Pancreatic cancer
    102187521 (AKT2)
   05225 Hepatocellular carcinoma
    102187521 (AKT2)
   05226 Gastric cancer
    102187521 (AKT2)
   05214 Glioma
    102187521 (AKT2)
   05221 Acute myeloid leukemia
    102187521 (AKT2)
   05220 Chronic myeloid leukemia
    102187521 (AKT2)
   05218 Melanoma
    102187521 (AKT2)
   05211 Renal cell carcinoma
    102187521 (AKT2)
   05215 Prostate cancer
    102187521 (AKT2)
   05213 Endometrial cancer
    102187521 (AKT2)
   05224 Breast cancer
    102187521 (AKT2)
   05222 Small cell lung cancer
    102187521 (AKT2)
   05223 Non-small cell lung cancer
    102187521 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102187521 (AKT2)
   05017 Spinocerebellar ataxia
    102187521 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102187521 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102187521 (AKT2)
   04931 Insulin resistance
    102187521 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102187521 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102187521 (AKT2)
   05135 Yersinia infection
    102187521 (AKT2)
   05152 Tuberculosis
    102187521 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102187521 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102187521 (AKT2)
   05161 Hepatitis B
    102187521 (AKT2)
   05160 Hepatitis C
    102187521 (AKT2)
   05164 Influenza A
    102187521 (AKT2)
   05162 Measles
    102187521 (AKT2)
   05168 Herpes simplex virus 1 infection
    102187521 (AKT2)
   05163 Human cytomegalovirus infection
    102187521 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102187521 (AKT2)
   05169 Epstein-Barr virus infection
    102187521 (AKT2)
   05165 Human papillomavirus infection
    102187521 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102187521 (AKT2)
   05142 Chagas disease
    102187521 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102187521 (AKT2)
   01524 Platinum drug resistance
    102187521 (AKT2)
   01522 Endocrine resistance
    102187521 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102187521 (AKT2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102187521 (AKT2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102187521 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 102187521
NCBI-ProteinID: XP_017917896
UniProt: A0A452EQ89
LinkDB
Position
18
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGADPM
DYKCGSPSDCSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgcggtgaatatatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggctataaggag
cggcctgaggcccccgaccagaccctgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagacctcggcccaataccttcgtcattcgctgtctgcagtgg
accacagtcatcgagaggaccttccatgtcgactccccggacgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaagcagcggggcccaggggcggaccccatg
gactacaagtgtggctcccccagcgactgttctgcggccgaggagatggaggtggcggtt
agcaaggcgcgggccaaggtgaccatgaatgactttgactatctcaaactcctgggcaag
ggcacctttggcaaggtcatcctggtgcgggagaaggccactggccgctactatgccatg
aagatcctgcggaaggaagtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgcgtcctgcagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ttgtcgcgggagcgtgtcttcacagaggagcgggcccgcttttatggcgcagagatcgtc
tcagccctggagtacctgcactcgcgggacgtagtgtaccgcgacataaagctggaaaac
ctcatgctggacaaggacggccacatcaagatcaccgacttcggcctgtgcaaggagggc
atcagcgacggggccaccatgaagactttctgtgggacacctgagtacctggcgcccgag
gtgctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggatcacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccctaagcagaggctcggcggagggcccagcgacgcc
aaggaggtcatggagcacaggttcttcctcagtatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaagcctcaggtcacatctgaggttgacacaaggtactttgac
gacgagttcaccgcccagtccatcacagtcacgcccccggaccgctatgacagcctgggc
tcactggagctggaccagcggacgcacttcccccagttctcctattcggccagcatccga
gagtga

DBGET integrated database retrieval system