Capra hircus (goat): 100860996 Help Entry 100860996         CDS       T02910                                  Gene name MAPK13 Definition (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism chx  Capra hircus (goat) Pathway chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04015   Rap1 signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04114   Oocyte meiosis chx04218   Cellular senescence chx04261   Adrenergic signaling in cardiomyocytes chx04370   VEGF signaling pathway chx04380   Osteoclast differentiation chx04550   Signaling pathways regulating pluripotency of stem cells chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04668   TNF signaling pathway chx04670   Leukocyte transendothelial migration chx04714   Thermogenesis chx04722   Neurotrophin signaling pathway chx04723   Retrograde endocannabinoid signaling chx04728   Dopaminergic synapse chx04750   Inflammatory mediator regulation of TRP channels chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04917   Prolactin signaling pathway chx04926   Relaxin signaling pathway chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx05014   Amyotrophic lateral sclerosis chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05152   Tuberculosis chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05205   Proteoglycans in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100860996 (MAPK13)    04015 Rap1 signaling pathway     100860996 (MAPK13)    04370 VEGF signaling pathway     100860996 (MAPK13)    04668 TNF signaling pathway     100860996 (MAPK13)    04068 FoxO signaling pathway     100860996 (MAPK13)    04071 Sphingolipid signaling pathway     100860996 (MAPK13)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100860996 (MAPK13)    04218 Cellular senescence     100860996 (MAPK13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100860996 (MAPK13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100860996 (MAPK13)    04613 Neutrophil extracellular trap formation     100860996 (MAPK13)    04620 Toll-like receptor signaling pathway     100860996 (MAPK13)    04621 NOD-like receptor signaling pathway     100860996 (MAPK13)    04622 RIG-I-like receptor signaling pathway     100860996 (MAPK13)    04625 C-type lectin receptor signaling pathway     100860996 (MAPK13)    04660 T cell receptor signaling pathway     100860996 (MAPK13)    04658 Th1 and Th2 cell differentiation     100860996 (MAPK13)    04659 Th17 cell differentiation     100860996 (MAPK13)    04657 IL-17 signaling pathway     100860996 (MAPK13)    04664 Fc epsilon RI signaling pathway     100860996 (MAPK13)    04670 Leukocyte transendothelial migration     100860996 (MAPK13)   09152 Endocrine system    04912 GnRH signaling pathway     100860996 (MAPK13)    04914 Progesterone-mediated oocyte maturation     100860996 (MAPK13)    04917 Prolactin signaling pathway     100860996 (MAPK13)    04926 Relaxin signaling pathway     100860996 (MAPK13)    04935 Growth hormone synthesis, secretion and action     100860996 (MAPK13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100860996 (MAPK13)   09156 Nervous system    04728 Dopaminergic synapse     100860996 (MAPK13)    04723 Retrograde endocannabinoid signaling     100860996 (MAPK13)    04722 Neurotrophin signaling pathway     100860996 (MAPK13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100860996 (MAPK13)   09158 Development and regeneration    04380 Osteoclast differentiation     100860996 (MAPK13)   09159 Environmental adaptation    04714 Thermogenesis     100860996 (MAPK13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100860996 (MAPK13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100860996 (MAPK13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100860996 (MAPK13)    05020 Prion disease     100860996 (MAPK13)    05022 Pathways of neurodegeneration - multiple diseases     100860996 (MAPK13)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100860996 (MAPK13)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100860996 (MAPK13)   09171 Infectious disease: bacterial    05132 Salmonella infection     100860996 (MAPK13)    05135 Yersinia infection     100860996 (MAPK13)    05133 Pertussis     100860996 (MAPK13)    05152 Tuberculosis     100860996 (MAPK13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100860996 (MAPK13)    05161 Hepatitis B     100860996 (MAPK13)    05171 Coronavirus disease - COVID-19     100860996 (MAPK13)    05163 Human cytomegalovirus infection     100860996 (MAPK13)    05167 Kaposi sarcoma-associated herpesvirus infection     100860996 (MAPK13)    05169 Epstein-Barr virus infection     100860996 (MAPK13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100860996 (MAPK13)    05140 Leishmaniasis     100860996 (MAPK13)    05142 Chagas disease     100860996 (MAPK13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100860996 (MAPK13)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     100860996 (MAPK13) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100860996 (MAPK13) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100860996 (MAPK13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like Kdo DUF4023 DUF3231 Motif Other DBs NCBI-GeneID:  100860996 NCBI-ProteinID:  XP_017894277 UniProt:  A0A452FU55 LinkDB All DBs Position 23 AA seq 366 aa AA seqDB search MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT GYVVTRWYRAPEVILSWMRYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLNDKAAKSYIQSLPQSPRKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS QALAHPFFEPFRDPEEETEAQQPLEDSLERERLTVDEWKQHIYKEIVNFSPIARKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctatggctccgtgtgc tcagccatcgacaagcggtcaggggaaaaggtggccatcaagaagctgagccggcccttc cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg gagttcagtgaggacaagatccagtacctggtgtaccagatgctcaagggtcttaagtac atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaacgag gactgcgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcgttac aaccagaccgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag acgctgttcaaggggaaagactacctggaccagctgacccagatcctgaaagtgactggg gtgccgggcgccgagtttgtgcagaagctgaatgacaaggcggccaaatcctacatccag tccctgccacaaagccccagaaaggatttctctcagctcttcccacgtgccagcccccag gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg caggcccttgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc cagcagccgctcgaagattccttagaacgcgagagactcacagtggacgaatggaagcag cacatctacaaggagattgtgaacttcagccccattgcccggaaggactctcggcgccgg agtggcatgaagttgcagtga

Capra hircus (goat): 102180926 Help Entry 102180926         CDS       T02910                                  Gene name MAPK12 Definition (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism chx  Capra hircus (goat) Pathway chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04015   Rap1 signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04114   Oocyte meiosis chx04218   Cellular senescence chx04261   Adrenergic signaling in cardiomyocytes chx04370   VEGF signaling pathway chx04380   Osteoclast differentiation chx04550   Signaling pathways regulating pluripotency of stem cells chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04668   TNF signaling pathway chx04670   Leukocyte transendothelial migration chx04714   Thermogenesis chx04722   Neurotrophin signaling pathway chx04723   Retrograde endocannabinoid signaling chx04728   Dopaminergic synapse chx04750   Inflammatory mediator regulation of TRP channels chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04917   Prolactin signaling pathway chx04926   Relaxin signaling pathway chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx05014   Amyotrophic lateral sclerosis chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05152   Tuberculosis chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05205   Proteoglycans in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102180926 (MAPK12)    04015 Rap1 signaling pathway     102180926 (MAPK12)    04370 VEGF signaling pathway     102180926 (MAPK12)    04668 TNF signaling pathway     102180926 (MAPK12)    04068 FoxO signaling pathway     102180926 (MAPK12)    04071 Sphingolipid signaling pathway     102180926 (MAPK12)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102180926 (MAPK12)    04218 Cellular senescence     102180926 (MAPK12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102180926 (MAPK12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102180926 (MAPK12)    04613 Neutrophil extracellular trap formation     102180926 (MAPK12)    04620 Toll-like receptor signaling pathway     102180926 (MAPK12)    04621 NOD-like receptor signaling pathway     102180926 (MAPK12)    04622 RIG-I-like receptor signaling pathway     102180926 (MAPK12)    04625 C-type lectin receptor signaling pathway     102180926 (MAPK12)    04660 T cell receptor signaling pathway     102180926 (MAPK12)    04658 Th1 and Th2 cell differentiation     102180926 (MAPK12)    04659 Th17 cell differentiation     102180926 (MAPK12)    04657 IL-17 signaling pathway     102180926 (MAPK12)    04664 Fc epsilon RI signaling pathway     102180926 (MAPK12)    04670 Leukocyte transendothelial migration     102180926 (MAPK12)   09152 Endocrine system    04912 GnRH signaling pathway     102180926 (MAPK12)    04914 Progesterone-mediated oocyte maturation     102180926 (MAPK12)    04917 Prolactin signaling pathway     102180926 (MAPK12)    04926 Relaxin signaling pathway     102180926 (MAPK12)    04935 Growth hormone synthesis, secretion and action     102180926 (MAPK12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102180926 (MAPK12)   09156 Nervous system    04728 Dopaminergic synapse     102180926 (MAPK12)    04723 Retrograde endocannabinoid signaling     102180926 (MAPK12)    04722 Neurotrophin signaling pathway     102180926 (MAPK12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102180926 (MAPK12)   09158 Development and regeneration    04380 Osteoclast differentiation     102180926 (MAPK12)   09159 Environmental adaptation    04714 Thermogenesis     102180926 (MAPK12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102180926 (MAPK12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102180926 (MAPK12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102180926 (MAPK12)    05020 Prion disease     102180926 (MAPK12)    05022 Pathways of neurodegeneration - multiple diseases     102180926 (MAPK12)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102180926 (MAPK12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102180926 (MAPK12)   09171 Infectious disease: bacterial    05132 Salmonella infection     102180926 (MAPK12)    05135 Yersinia infection     102180926 (MAPK12)    05133 Pertussis     102180926 (MAPK12)    05152 Tuberculosis     102180926 (MAPK12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102180926 (MAPK12)    05161 Hepatitis B     102180926 (MAPK12)    05171 Coronavirus disease - COVID-19     102180926 (MAPK12)    05163 Human cytomegalovirus infection     102180926 (MAPK12)    05167 Kaposi sarcoma-associated herpesvirus infection     102180926 (MAPK12)    05169 Epstein-Barr virus infection     102180926 (MAPK12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102180926 (MAPK12)    05140 Leishmaniasis     102180926 (MAPK12)    05142 Chagas disease     102180926 (MAPK12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102180926 (MAPK12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     102180926 (MAPK12) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102180926 (MAPK12) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102180926 (MAPK12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Motif Other DBs NCBI-GeneID:  102180926 NCBI-ProteinID:  XP_017904445 LinkDB All DBs Position 5 AA seq 376 aa AA seqDB search MGSSLPSLAEVKDAYRLAWLPGGVLGVSPGLPILSSLPPVQRHHSAFFRPPPLPQTSVSL VTLRKRQNTVLTCLVSRGPRGGARGSAVGGGDCVSQGDGAPCGPERLCPIVRCSYLVMPF MGTDLGKLMKHEKLSEDRVQFLVYQTLKGLKYIHAAGVIHRDLKPSNLAVNEDCELKILD FGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGNDH LDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASVLTNASPLAVSLLEKM LVLDAEQRVTAAEALAHPYFESLHDTEDEPQAQKYDESFDDVDRTLDEWKRVTYKEVLSF KPPRQLGAKASKETAL NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt atgggctcctcgctgcccagcctcgcggaggtcaaggacgcatacagactggcctggctt cctggtggggtgcttggggtgtctcccggtctccccatcctgtccagcttgccccctgtc cagaggcaccactctgctttttttcgcccccctcccctgcctcaaacctcggtctccctg gttacccttcggaaacgccaaaacacagtcctcacctgcctggtgtcgcggggcccgcgg ggtggggcccggggcagcgccgtgggaggcggggactgcgtgtcgcagggtgacggggcc ccgtgcggccctgagcgtctctgccccatcgtgcgctgcagctacctggtgatgccgttc atgggcaccgacctgggaaagctcatgaagcacgagaagctgagcgaagaccgggtgcag ttcctcgtctaccagacgctcaaggggctgaagtacatccacgctgccggcgtcatccat agggacctgaagcccagcaacctggctgtgaacgaggactgtgagctgaagatcctggac ttcggcctggcccggcaggcagacagcgagatgaccggctacgtggtgacccggtggtac cgcgcgcccgaggtcatcctgaactggatgcgctacacgcagacggtggacatctggtcc gtgggctgcatcatggctgagatgatcacagggaagacgctcttcaaaggcaacgaccac ctggaccagctgaaggagatcatgaaggtgacagggacgcctcccgcggagtttgtgcag aggctgcaaagtgacgaggccaagaactacatgaaaggcctccctgagctggagaagaag gattttgcctccgtcctgaccaacgcaagccccctggccgtgagcctcctggagaaaatg ctggtgctggatgcagagcagcgggtgacggcggccgaggcgctggcccatccctacttc gagtcactgcacgacacggaggacgagccccaggcccagaagtacgatgagtcctttgac gacgtggaccgcacgctggacgagtggaagcgtgtcacatataaagaggtgctcagcttc aagcctccccggcagctgggggccaaggcctccaaggagacagccttgtga

Capra hircus (goat): 102189174 Help Entry 102189174         CDS       T02910                                  Gene name MAPK14 Definition (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism chx  Capra hircus (goat) Pathway chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04015   Rap1 signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04114   Oocyte meiosis chx04218   Cellular senescence chx04261   Adrenergic signaling in cardiomyocytes chx04370   VEGF signaling pathway chx04380   Osteoclast differentiation chx04550   Signaling pathways regulating pluripotency of stem cells chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04625   C-type lectin receptor signaling pathway chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04668   TNF signaling pathway chx04670   Leukocyte transendothelial migration chx04714   Thermogenesis chx04722   Neurotrophin signaling pathway chx04723   Retrograde endocannabinoid signaling chx04728   Dopaminergic synapse chx04750   Inflammatory mediator regulation of TRP channels chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04917   Prolactin signaling pathway chx04926   Relaxin signaling pathway chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx05014   Amyotrophic lateral sclerosis chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05133   Pertussis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05145   Toxoplasmosis chx05152   Tuberculosis chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05205   Proteoglycans in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102189174 (MAPK14)    04015 Rap1 signaling pathway     102189174 (MAPK14)    04370 VEGF signaling pathway     102189174 (MAPK14)    04668 TNF signaling pathway     102189174 (MAPK14)    04068 FoxO signaling pathway     102189174 (MAPK14)    04071 Sphingolipid signaling pathway     102189174 (MAPK14)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102189174 (MAPK14)    04218 Cellular senescence     102189174 (MAPK14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102189174 (MAPK14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102189174 (MAPK14)    04613 Neutrophil extracellular trap formation     102189174 (MAPK14)    04620 Toll-like receptor signaling pathway     102189174 (MAPK14)    04621 NOD-like receptor signaling pathway     102189174 (MAPK14)    04622 RIG-I-like receptor signaling pathway     102189174 (MAPK14)    04625 C-type lectin receptor signaling pathway     102189174 (MAPK14)    04660 T cell receptor signaling pathway     102189174 (MAPK14)    04658 Th1 and Th2 cell differentiation     102189174 (MAPK14)    04659 Th17 cell differentiation     102189174 (MAPK14)    04657 IL-17 signaling pathway     102189174 (MAPK14)    04664 Fc epsilon RI signaling pathway     102189174 (MAPK14)    04670 Leukocyte transendothelial migration     102189174 (MAPK14)   09152 Endocrine system    04912 GnRH signaling pathway     102189174 (MAPK14)    04914 Progesterone-mediated oocyte maturation     102189174 (MAPK14)    04917 Prolactin signaling pathway     102189174 (MAPK14)    04926 Relaxin signaling pathway     102189174 (MAPK14)    04935 Growth hormone synthesis, secretion and action     102189174 (MAPK14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102189174 (MAPK14)   09156 Nervous system    04728 Dopaminergic synapse     102189174 (MAPK14)    04723 Retrograde endocannabinoid signaling     102189174 (MAPK14)    04722 Neurotrophin signaling pathway     102189174 (MAPK14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102189174 (MAPK14)   09158 Development and regeneration    04380 Osteoclast differentiation     102189174 (MAPK14)   09159 Environmental adaptation    04714 Thermogenesis     102189174 (MAPK14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102189174 (MAPK14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102189174 (MAPK14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102189174 (MAPK14)    05020 Prion disease     102189174 (MAPK14)    05022 Pathways of neurodegeneration - multiple diseases     102189174 (MAPK14)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102189174 (MAPK14)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102189174 (MAPK14)   09171 Infectious disease: bacterial    05132 Salmonella infection     102189174 (MAPK14)    05135 Yersinia infection     102189174 (MAPK14)    05133 Pertussis     102189174 (MAPK14)    05152 Tuberculosis     102189174 (MAPK14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102189174 (MAPK14)    05161 Hepatitis B     102189174 (MAPK14)    05171 Coronavirus disease - COVID-19     102189174 (MAPK14)    05163 Human cytomegalovirus infection     102189174 (MAPK14)    05167 Kaposi sarcoma-associated herpesvirus infection     102189174 (MAPK14)    05169 Epstein-Barr virus infection     102189174 (MAPK14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102189174 (MAPK14)    05140 Leishmaniasis     102189174 (MAPK14)    05142 Chagas disease     102189174 (MAPK14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102189174 (MAPK14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     102189174 (MAPK14) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102189174 (MAPK14) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102189174 (MAPK14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like Motif Other DBs NCBI-GeneID:  102189174 NCBI-ProteinID:  XP_017894280 LinkDB All DBs Position 23 AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct gcttttgacacaaaaactgggttacgtgtcgcagtaaagaagctatccagaccatttcag tccattattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaagcat gaaaatgtgattggtctgttggatgttttcacacctgcgaggtctctggaggaattcaat gatgtgtacctggtgacccacctcatgggagcagatctgaacaacatcgtgaaatgtcag aagcttacagatgaccacgttcagttccttatctaccagattctcagaggtctcaagtat atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa gactgtgagctgaagatcttggatttcggactggctcgacacacagatgatgaaatgaca ggctatgtggccaccaggtggtacagggctcctgagatcatgctcaactggatgcattac aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg gctgtcgacctgctggagaagatgcttgtattggactcagataagagaattacagcggcg caggcccttgcgcacgcctactttgcccagtaccacgatcctgatgacgagccagtggct gatccttacgaccagtctttcgaaagcagggacctccttatagacgaatggaaaagtctg acctatgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtct tga

DBGET integrated database retrieval system