KEGG   Capra hircus (goat): 100860996
Entry
100860996         CDS       T02910                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04015  Rap1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04714  Thermogenesis
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04926  Relaxin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05205  Proteoglycans in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100860996 (MAPK13)
   04015 Rap1 signaling pathway
    100860996 (MAPK13)
   04370 VEGF signaling pathway
    100860996 (MAPK13)
   04668 TNF signaling pathway
    100860996 (MAPK13)
   04068 FoxO signaling pathway
    100860996 (MAPK13)
   04071 Sphingolipid signaling pathway
    100860996 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100860996 (MAPK13)
   04218 Cellular senescence
    100860996 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100860996 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100860996 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100860996 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100860996 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100860996 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100860996 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100860996 (MAPK13)
   04660 T cell receptor signaling pathway
    100860996 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100860996 (MAPK13)
   04659 Th17 cell differentiation
    100860996 (MAPK13)
   04657 IL-17 signaling pathway
    100860996 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100860996 (MAPK13)
   04670 Leukocyte transendothelial migration
    100860996 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100860996 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100860996 (MAPK13)
   04917 Prolactin signaling pathway
    100860996 (MAPK13)
   04926 Relaxin signaling pathway
    100860996 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100860996 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100860996 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100860996 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100860996 (MAPK13)
   04722 Neurotrophin signaling pathway
    100860996 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100860996 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100860996 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100860996 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100860996 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100860996 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100860996 (MAPK13)
   05020 Prion disease
    100860996 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100860996 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100860996 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100860996 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100860996 (MAPK13)
   05135 Yersinia infection
    100860996 (MAPK13)
   05133 Pertussis
    100860996 (MAPK13)
   05152 Tuberculosis
    100860996 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100860996 (MAPK13)
   05161 Hepatitis B
    100860996 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100860996 (MAPK13)
   05163 Human cytomegalovirus infection
    100860996 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100860996 (MAPK13)
   05169 Epstein-Barr virus infection
    100860996 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100860996 (MAPK13)
   05140 Leishmaniasis
    100860996 (MAPK13)
   05142 Chagas disease
    100860996 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100860996 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100860996 (MAPK13)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100860996 (MAPK13)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100860996 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like Kdo DUF4023 DUF3231
Other DBs
NCBI-GeneID: 100860996
NCBI-ProteinID: XP_017894277
UniProt: A0A452FU55
LinkDB
Position
23
AA seq 366 aa
MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT
GYVVTRWYRAPEVILSWMRYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPRKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQQPLEDSLERERLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctatggctccgtgtgc
tcagccatcgacaagcggtcaggggaaaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtaccagatgctcaagggtcttaagtac
atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaacgag
gactgcgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg
ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcgttac
aaccagaccgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag
acgctgttcaaggggaaagactacctggaccagctgacccagatcctgaaagtgactggg
gtgccgggcgccgagtttgtgcagaagctgaatgacaaggcggccaaatcctacatccag
tccctgccacaaagccccagaaaggatttctctcagctcttcccacgtgccagcccccag
gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg
caggcccttgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc
cagcagccgctcgaagattccttagaacgcgagagactcacagtggacgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactctcggcgccgg
agtggcatgaagttgcagtga

KEGG   Capra hircus (goat): 102180926
Entry
102180926         CDS       T02910                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04015  Rap1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04714  Thermogenesis
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04926  Relaxin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05205  Proteoglycans in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102180926 (MAPK12)
   04015 Rap1 signaling pathway
    102180926 (MAPK12)
   04370 VEGF signaling pathway
    102180926 (MAPK12)
   04668 TNF signaling pathway
    102180926 (MAPK12)
   04068 FoxO signaling pathway
    102180926 (MAPK12)
   04071 Sphingolipid signaling pathway
    102180926 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102180926 (MAPK12)
   04218 Cellular senescence
    102180926 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102180926 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102180926 (MAPK12)
   04613 Neutrophil extracellular trap formation
    102180926 (MAPK12)
   04620 Toll-like receptor signaling pathway
    102180926 (MAPK12)
   04621 NOD-like receptor signaling pathway
    102180926 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    102180926 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    102180926 (MAPK12)
   04660 T cell receptor signaling pathway
    102180926 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    102180926 (MAPK12)
   04659 Th17 cell differentiation
    102180926 (MAPK12)
   04657 IL-17 signaling pathway
    102180926 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    102180926 (MAPK12)
   04670 Leukocyte transendothelial migration
    102180926 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102180926 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    102180926 (MAPK12)
   04917 Prolactin signaling pathway
    102180926 (MAPK12)
   04926 Relaxin signaling pathway
    102180926 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    102180926 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102180926 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    102180926 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    102180926 (MAPK12)
   04722 Neurotrophin signaling pathway
    102180926 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102180926 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102180926 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    102180926 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102180926 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102180926 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102180926 (MAPK12)
   05020 Prion disease
    102180926 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    102180926 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102180926 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102180926 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102180926 (MAPK12)
   05135 Yersinia infection
    102180926 (MAPK12)
   05133 Pertussis
    102180926 (MAPK12)
   05152 Tuberculosis
    102180926 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102180926 (MAPK12)
   05161 Hepatitis B
    102180926 (MAPK12)
   05171 Coronavirus disease - COVID-19
    102180926 (MAPK12)
   05163 Human cytomegalovirus infection
    102180926 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102180926 (MAPK12)
   05169 Epstein-Barr virus infection
    102180926 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102180926 (MAPK12)
   05140 Leishmaniasis
    102180926 (MAPK12)
   05142 Chagas disease
    102180926 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102180926 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102180926 (MAPK12)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102180926 (MAPK12)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102180926 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 102180926
NCBI-ProteinID: XP_017904445
LinkDB
Position
5
AA seq 376 aa
MGSSLPSLAEVKDAYRLAWLPGGVLGVSPGLPILSSLPPVQRHHSAFFRPPPLPQTSVSL
VTLRKRQNTVLTCLVSRGPRGGARGSAVGGGDCVSQGDGAPCGPERLCPIVRCSYLVMPF
MGTDLGKLMKHEKLSEDRVQFLVYQTLKGLKYIHAAGVIHRDLKPSNLAVNEDCELKILD
FGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGNDH
LDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASVLTNASPLAVSLLEKM
LVLDAEQRVTAAEALAHPYFESLHDTEDEPQAQKYDESFDDVDRTLDEWKRVTYKEVLSF
KPPRQLGAKASKETAL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgggctcctcgctgcccagcctcgcggaggtcaaggacgcatacagactggcctggctt
cctggtggggtgcttggggtgtctcccggtctccccatcctgtccagcttgccccctgtc
cagaggcaccactctgctttttttcgcccccctcccctgcctcaaacctcggtctccctg
gttacccttcggaaacgccaaaacacagtcctcacctgcctggtgtcgcggggcccgcgg
ggtggggcccggggcagcgccgtgggaggcggggactgcgtgtcgcagggtgacggggcc
ccgtgcggccctgagcgtctctgccccatcgtgcgctgcagctacctggtgatgccgttc
atgggcaccgacctgggaaagctcatgaagcacgagaagctgagcgaagaccgggtgcag
ttcctcgtctaccagacgctcaaggggctgaagtacatccacgctgccggcgtcatccat
agggacctgaagcccagcaacctggctgtgaacgaggactgtgagctgaagatcctggac
ttcggcctggcccggcaggcagacagcgagatgaccggctacgtggtgacccggtggtac
cgcgcgcccgaggtcatcctgaactggatgcgctacacgcagacggtggacatctggtcc
gtgggctgcatcatggctgagatgatcacagggaagacgctcttcaaaggcaacgaccac
ctggaccagctgaaggagatcatgaaggtgacagggacgcctcccgcggagtttgtgcag
aggctgcaaagtgacgaggccaagaactacatgaaaggcctccctgagctggagaagaag
gattttgcctccgtcctgaccaacgcaagccccctggccgtgagcctcctggagaaaatg
ctggtgctggatgcagagcagcgggtgacggcggccgaggcgctggcccatccctacttc
gagtcactgcacgacacggaggacgagccccaggcccagaagtacgatgagtcctttgac
gacgtggaccgcacgctggacgagtggaagcgtgtcacatataaagaggtgctcagcttc
aagcctccccggcagctgggggccaaggcctccaaggagacagccttgtga

KEGG   Capra hircus (goat): 102189174
Entry
102189174         CDS       T02910                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04015  Rap1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04714  Thermogenesis
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04926  Relaxin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05205  Proteoglycans in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102189174 (MAPK14)
   04015 Rap1 signaling pathway
    102189174 (MAPK14)
   04370 VEGF signaling pathway
    102189174 (MAPK14)
   04668 TNF signaling pathway
    102189174 (MAPK14)
   04068 FoxO signaling pathway
    102189174 (MAPK14)
   04071 Sphingolipid signaling pathway
    102189174 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102189174 (MAPK14)
   04218 Cellular senescence
    102189174 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102189174 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102189174 (MAPK14)
   04613 Neutrophil extracellular trap formation
    102189174 (MAPK14)
   04620 Toll-like receptor signaling pathway
    102189174 (MAPK14)
   04621 NOD-like receptor signaling pathway
    102189174 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    102189174 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    102189174 (MAPK14)
   04660 T cell receptor signaling pathway
    102189174 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    102189174 (MAPK14)
   04659 Th17 cell differentiation
    102189174 (MAPK14)
   04657 IL-17 signaling pathway
    102189174 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    102189174 (MAPK14)
   04670 Leukocyte transendothelial migration
    102189174 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102189174 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    102189174 (MAPK14)
   04917 Prolactin signaling pathway
    102189174 (MAPK14)
   04926 Relaxin signaling pathway
    102189174 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    102189174 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102189174 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    102189174 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    102189174 (MAPK14)
   04722 Neurotrophin signaling pathway
    102189174 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102189174 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102189174 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    102189174 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102189174 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102189174 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102189174 (MAPK14)
   05020 Prion disease
    102189174 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    102189174 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102189174 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102189174 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102189174 (MAPK14)
   05135 Yersinia infection
    102189174 (MAPK14)
   05133 Pertussis
    102189174 (MAPK14)
   05152 Tuberculosis
    102189174 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102189174 (MAPK14)
   05161 Hepatitis B
    102189174 (MAPK14)
   05171 Coronavirus disease - COVID-19
    102189174 (MAPK14)
   05163 Human cytomegalovirus infection
    102189174 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102189174 (MAPK14)
   05169 Epstein-Barr virus infection
    102189174 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102189174 (MAPK14)
   05140 Leishmaniasis
    102189174 (MAPK14)
   05142 Chagas disease
    102189174 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102189174 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102189174 (MAPK14)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102189174 (MAPK14)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102189174 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 102189174
NCBI-ProteinID: XP_017894280
LinkDB
Position
23
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtcgcagtaaagaagctatccagaccatttcag
tccattattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaagcat
gaaaatgtgattggtctgttggatgttttcacacctgcgaggtctctggaggaattcaat
gatgtgtacctggtgacccacctcatgggagcagatctgaacaacatcgtgaaatgtcag
aagcttacagatgaccacgttcagttccttatctaccagattctcagaggtctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggatttcggactggctcgacacacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctcaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacctgctggagaagatgcttgtattggactcagataagagaattacagcggcg
caggcccttgcgcacgcctactttgcccagtaccacgatcctgatgacgagccagtggct
gatccttacgaccagtctttcgaaagcagggacctccttatagacgaatggaaaagtctg
acctatgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtct
tga

DBGET integrated database retrieval system