KEGG   Capra hircus (goat): 100861087
Entry
100861087         CDS       T02910                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04024  cAMP signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04137  Mitophagy - animal
chx04140  Autophagy - animal
chx04141  Protein processing in endoplasmic reticulum
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04530  Tight junction
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04926  Relaxin signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05231  Choline metabolism in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100861087 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861087 (MAPK8)
   04012 ErbB signaling pathway
    100861087 (MAPK8)
   04014 Ras signaling pathway
    100861087 (MAPK8)
   04310 Wnt signaling pathway
    100861087 (MAPK8)
   04668 TNF signaling pathway
    100861087 (MAPK8)
   04068 FoxO signaling pathway
    100861087 (MAPK8)
   04071 Sphingolipid signaling pathway
    100861087 (MAPK8)
   04024 cAMP signaling pathway
    100861087 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100861087 (MAPK8)
   04137 Mitophagy - animal
    100861087 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100861087 (MAPK8)
   04215 Apoptosis - multiple species
    100861087 (MAPK8)
   04217 Necroptosis
    100861087 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100861087 (MAPK8)
   04530 Tight junction
    100861087 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100861087 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100861087 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100861087 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100861087 (MAPK8)
   04660 T cell receptor signaling pathway
    100861087 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100861087 (MAPK8)
   04659 Th17 cell differentiation
    100861087 (MAPK8)
   04657 IL-17 signaling pathway
    100861087 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100861087 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100861087 (MAPK8)
   04920 Adipocytokine signaling pathway
    100861087 (MAPK8)
   04912 GnRH signaling pathway
    100861087 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100861087 (MAPK8)
   04917 Prolactin signaling pathway
    100861087 (MAPK8)
   04926 Relaxin signaling pathway
    100861087 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100861087 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100861087 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100861087 (MAPK8)
   04722 Neurotrophin signaling pathway
    100861087 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100861087 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100861087 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861087 (MAPK8)
   05231 Choline metabolism in cancer
    100861087 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100861087 (MAPK8)
   05212 Pancreatic cancer
    100861087 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100861087 (MAPK8)
   05012 Parkinson disease
    100861087 (MAPK8)
   05016 Huntington disease
    100861087 (MAPK8)
   05017 Spinocerebellar ataxia
    100861087 (MAPK8)
   05020 Prion disease
    100861087 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100861087 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100861087 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100861087 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100861087 (MAPK8)
   04931 Insulin resistance
    100861087 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100861087 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100861087 (MAPK8)
   05135 Yersinia infection
    100861087 (MAPK8)
   05133 Pertussis
    100861087 (MAPK8)
   05152 Tuberculosis
    100861087 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100861087 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100861087 (MAPK8)
   05161 Hepatitis B
    100861087 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100861087 (MAPK8)
   05162 Measles
    100861087 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100861087 (MAPK8)
   05169 Epstein-Barr virus infection
    100861087 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100861087 (MAPK8)
   05142 Chagas disease
    100861087 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100861087 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100861087 (MAPK8)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100861087 (MAPK8)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100861087 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100861087
NCBI-ProteinID: XP_017897916
UniProt: A0A452G3A1
LinkDB
Position
28
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTVEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVTSGSQRPSSSSSANDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctatcggttcaggagcccaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaacgttgcaatcaagaagctaagtcggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgtc
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaggatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctaccagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaagtatgctggatatagctttgagaagctcttccctgatgtacttttc
ccagctgactcggaacacaataaacttaaagccagtcaggcaagggatctgttatccaaa
atgctggtaattgacgcgtctaaacggatctctgtagatgaagctctccagcacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagctagatgaaagggagcacacagtggaggagtggaaagaattgatatacaaagaagtt
atggacttggaggaaagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgaccagtggctctcagcgtccgtcatcatcgtcgtctgccaatgatgtgtcc
tcaatgtcaacagatccgaccttggcctcggatacagacagcagtctagaagcgtcggct
gggcctctgggctgctgtagatga

KEGG   Capra hircus (goat): 102170408
Entry
102170408         CDS       T02910                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04024  cAMP signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04137  Mitophagy - animal
chx04140  Autophagy - animal
chx04141  Protein processing in endoplasmic reticulum
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04530  Tight junction
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04926  Relaxin signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05231  Choline metabolism in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102170408 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102170408 (MAPK9)
   04012 ErbB signaling pathway
    102170408 (MAPK9)
   04014 Ras signaling pathway
    102170408 (MAPK9)
   04310 Wnt signaling pathway
    102170408 (MAPK9)
   04668 TNF signaling pathway
    102170408 (MAPK9)
   04068 FoxO signaling pathway
    102170408 (MAPK9)
   04071 Sphingolipid signaling pathway
    102170408 (MAPK9)
   04024 cAMP signaling pathway
    102170408 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102170408 (MAPK9)
   04137 Mitophagy - animal
    102170408 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102170408 (MAPK9)
   04215 Apoptosis - multiple species
    102170408 (MAPK9)
   04217 Necroptosis
    102170408 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102170408 (MAPK9)
   04530 Tight junction
    102170408 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102170408 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102170408 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102170408 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102170408 (MAPK9)
   04660 T cell receptor signaling pathway
    102170408 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    102170408 (MAPK9)
   04659 Th17 cell differentiation
    102170408 (MAPK9)
   04657 IL-17 signaling pathway
    102170408 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    102170408 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102170408 (MAPK9)
   04920 Adipocytokine signaling pathway
    102170408 (MAPK9)
   04912 GnRH signaling pathway
    102170408 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102170408 (MAPK9)
   04917 Prolactin signaling pathway
    102170408 (MAPK9)
   04926 Relaxin signaling pathway
    102170408 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    102170408 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    102170408 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    102170408 (MAPK9)
   04722 Neurotrophin signaling pathway
    102170408 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102170408 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102170408 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102170408 (MAPK9)
   05231 Choline metabolism in cancer
    102170408 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102170408 (MAPK9)
   05212 Pancreatic cancer
    102170408 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102170408 (MAPK9)
   05012 Parkinson disease
    102170408 (MAPK9)
   05016 Huntington disease
    102170408 (MAPK9)
   05017 Spinocerebellar ataxia
    102170408 (MAPK9)
   05020 Prion disease
    102170408 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    102170408 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102170408 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102170408 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    102170408 (MAPK9)
   04931 Insulin resistance
    102170408 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102170408 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102170408 (MAPK9)
   05135 Yersinia infection
    102170408 (MAPK9)
   05133 Pertussis
    102170408 (MAPK9)
   05152 Tuberculosis
    102170408 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102170408 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    102170408 (MAPK9)
   05161 Hepatitis B
    102170408 (MAPK9)
   05171 Coronavirus disease - COVID-19
    102170408 (MAPK9)
   05162 Measles
    102170408 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102170408 (MAPK9)
   05169 Epstein-Barr virus infection
    102170408 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102170408 (MAPK9)
   05142 Chagas disease
    102170408 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102170408 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102170408 (MAPK9)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102170408 (MAPK9)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102170408 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102170408
NCBI-ProteinID: XP_017907107
UniProt: A0A452EJ55
LinkDB
Position
7
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagccagttctacagtgtacaagtggcagactcaactttc
actgtcctgaaacggtaccagcagttgaaacccattggctctggagcccagggaatcgtg
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcatatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatctgaagcctagtaacattgtagtaaag
tcagactgcacccttaagatcctggactttggcctggctcgcacagcgtgcaccaacttt
atgatgactccctatgtggtgacgcggtattaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttattatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtctggtatgaccctgcggaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagagagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcaaccttcagatgcagca
gtgagcagcaacgccactccttctcaatcgtcgtccatcaacgacatttcatccatgtcc
acggagcagacgctggcctcagacacagacagcagtctggacgcctcgacaggacccctg
gaaggctgtcgatga

KEGG   Capra hircus (goat): 102182774
Entry
102182774         CDS       T02910                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04024  cAMP signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04137  Mitophagy - animal
chx04140  Autophagy - animal
chx04141  Protein processing in endoplasmic reticulum
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04530  Tight junction
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04926  Relaxin signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05231  Choline metabolism in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102182774 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102182774 (MAPK10)
   04012 ErbB signaling pathway
    102182774 (MAPK10)
   04014 Ras signaling pathway
    102182774 (MAPK10)
   04310 Wnt signaling pathway
    102182774 (MAPK10)
   04668 TNF signaling pathway
    102182774 (MAPK10)
   04068 FoxO signaling pathway
    102182774 (MAPK10)
   04071 Sphingolipid signaling pathway
    102182774 (MAPK10)
   04024 cAMP signaling pathway
    102182774 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102182774 (MAPK10)
   04137 Mitophagy - animal
    102182774 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102182774 (MAPK10)
   04215 Apoptosis - multiple species
    102182774 (MAPK10)
   04217 Necroptosis
    102182774 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102182774 (MAPK10)
   04530 Tight junction
    102182774 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102182774 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102182774 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102182774 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102182774 (MAPK10)
   04660 T cell receptor signaling pathway
    102182774 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102182774 (MAPK10)
   04659 Th17 cell differentiation
    102182774 (MAPK10)
   04657 IL-17 signaling pathway
    102182774 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102182774 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102182774 (MAPK10)
   04920 Adipocytokine signaling pathway
    102182774 (MAPK10)
   04912 GnRH signaling pathway
    102182774 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102182774 (MAPK10)
   04917 Prolactin signaling pathway
    102182774 (MAPK10)
   04926 Relaxin signaling pathway
    102182774 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102182774 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102182774 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102182774 (MAPK10)
   04722 Neurotrophin signaling pathway
    102182774 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102182774 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102182774 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102182774 (MAPK10)
   05231 Choline metabolism in cancer
    102182774 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102182774 (MAPK10)
   05212 Pancreatic cancer
    102182774 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102182774 (MAPK10)
   05012 Parkinson disease
    102182774 (MAPK10)
   05016 Huntington disease
    102182774 (MAPK10)
   05017 Spinocerebellar ataxia
    102182774 (MAPK10)
   05020 Prion disease
    102182774 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102182774 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102182774 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102182774 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102182774 (MAPK10)
   04931 Insulin resistance
    102182774 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102182774 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102182774 (MAPK10)
   05135 Yersinia infection
    102182774 (MAPK10)
   05133 Pertussis
    102182774 (MAPK10)
   05152 Tuberculosis
    102182774 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102182774 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102182774 (MAPK10)
   05161 Hepatitis B
    102182774 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102182774 (MAPK10)
   05162 Measles
    102182774 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182774 (MAPK10)
   05169 Epstein-Barr virus infection
    102182774 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102182774 (MAPK10)
   05142 Chagas disease
    102182774 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102182774 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102182774 (MAPK10)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102182774 (MAPK10)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102182774 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102182774
NCBI-ProteinID: XP_005681918
LinkDB
Position
6
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaggttgacaaccagttctatagtgtggaagtgggggactcaacgtttacggtt
ctcaaacgctaccagaatctaaagcctattggctctggggctcagggaatagtctgcgct
gcatacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcctaccgggagctggtcctcatgaagtgtgtgaatcat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacattggaggagttccaa
gatgtttacttagtgatggaactgatggatgctaacttgtgtcaggtcattcagatggag
ttagaccacgagcgaatgtcgtacctactataccaaatgttgtgtggcatcaagcacctt
cactctgctgggattatccacagggacttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagactttgggctggccagaacagcaggcacaagcttcatgatg
actccctatgtggtaacacgttattaccgggcccccgaggtcattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctgtttccaggaagggactatattgaccagtggaataaggttattgagcaactagga
acaccatgtccagagttcatgaagaaattgcaacccaccgtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagagacttgctgtcaaagatgcta
gtgattgacccagcgaaaaggatatcagtggatgacgccttacaacatccatacatcaat
gtctggtacgaccctgctgaagtggaggcgcccccacctcagatatatgacaaacagctg
gatgagagagaacacaccattgaagaatggaaagaacttatctataaggaagtaatgaac
tcagaagaaaagaccaagaatggcgttgtgaaaggacagccttctccttcaggtgcagcc
gtgaacagcagtgagagtctccctccttcctcatccgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system