KEGG   Capra hircus (goat): 100861226
Entry
100861226         CDS       T02910                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04145  Phagosome
chx04620  Toll-like receptor signaling pathway
chx04640  Hematopoietic cell lineage
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861226 (CD14)
   04064 NF-kappa B signaling pathway
    100861226 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100861226 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100861226 (CD14)
   04620 Toll-like receptor signaling pathway
    100861226 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100861226 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100861226 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100861226 (CD14)
   05133 Pertussis
    100861226 (CD14)
   05134 Legionellosis
    100861226 (CD14)
   05152 Tuberculosis
    100861226 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100861226 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    100861226 (CD14)
   04090 CD molecules [BR:chx04090]
    100861226 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
    100861226 (CD14)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100861226 (CD14)
CD molecules [BR:chx04090]
 Proteins
  100861226 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
 Receptors
  100861226 (CD14)
SSDB
Motif
Pfam: LRR_4 LRR_6
Other DBs
NCBI-GeneID: 100861226
NCBI-ProteinID: NP_001272512
UniProt: Q1PBC9
LinkDB
AA seq 373 aa
MVCVPYLLLLLLSALLRVTADKREPCELDPQHFRCVCNFTDPKPDWSSAVQCMVAVEVEI
RGGGHSLDQFLKGANTDPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLKEL
TLEDLEVTGPTPPAPLEATGPALTTLSLRNVSGTTGGAWLGELQPWLKPGLRALNIAQAH
SLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFRAPQYLALRNAGMEAATRPC
APLAAARVQPQNLDLSHNSLRVTAPGATRCVWPSAISSLNCSFAGLEQVPKGLPPKLSVL
DLSCNKLSREPRRDELPYVNVLTVNGNPFLDPGALQHQNDPMISRMIPDRAPPSLVIGVS
GALVLYQGARGFA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggtgtgcgtgccctacctgctgctgctgctgctgtccgcactgctgcgtgtgactgcg
gacaaaagagagccctgcgagctggatccacagcatttccgctgtgtctgcaacttcacg
gatccgaagcctgactggtctagcgccgttcagtgtatggttgccgtcgaggtggagatc
cgtggcggcggccacagcctggaccagtttctcaagggagccaacaccgacccgaagcag
tatgctgacacaatcaaggctctgcgcgttcggcgactcaagctgggcgctgcacaggtt
cctgctcagcttctggtcgccgttctgcgcgcgctcgggtactctcgtctcaaggaactg
acgcttgaggacctggaggtaactggcccaacgcccccggcgcctctggaagccactggg
cctgcgctcaccaccctcagtctccgtaacgtgtcgggcacaacaggaggtgcctggctc
ggcgaactgcagccatggctcaagcctgggctcagggcgctgaacattgcccaagcacac
tcgcttgcctttccctgcgcagggctctccaccttcgaggcgctcaccaccctagacctg
tctgacaatcccagtctcggcgacagcgggctgatggcggctctctgtccgaacaagttc
cgggcccctcaatatttagcactacgcaacgcggggatggaggcggcgacccgcccgtgc
gcgccgctggcggcagcgagggtgcagccccaaaacctggacctcagccacaactcgctg
cgcgtcaccgccccgggcgctacccgatgtgtctggcccagtgccataagctctctcaat
tgttcgttcgctgggctggagcaagtgcctaaaggactgccgcccaagctcagcgtgctt
gatctcagctgcaacaagctaagcagggagccgcggcgagacgagctgccctatgtaaat
gtcctgactgtgaacggaaatccctttctggaccctggagccctccagcaccaaaatgac
ccgatgatctcccgtatgattccagaccgtgcccccccatctctggtcataggggtgtca
ggagccctggtcttgtatcaaggagcccgaggcttcgcgtaa

KEGG   Capra hircus (goat): 102177056
Entry
102177056         CDS       T02910                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04145  Phagosome
chx04620  Toll-like receptor signaling pathway
chx04640  Hematopoietic cell lineage
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102177056 (CD14)
   04064 NF-kappa B signaling pathway
    102177056 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102177056 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102177056 (CD14)
   04620 Toll-like receptor signaling pathway
    102177056 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102177056 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102177056 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102177056 (CD14)
   05133 Pertussis
    102177056 (CD14)
   05134 Legionellosis
    102177056 (CD14)
   05152 Tuberculosis
    102177056 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102177056 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102177056 (CD14)
   04090 CD molecules [BR:chx04090]
    102177056 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
    102177056 (CD14)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102177056 (CD14)
CD molecules [BR:chx04090]
 Proteins
  102177056 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
 Receptors
  102177056 (CD14)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_6
Other DBs
NCBI-GeneID: 102177056
NCBI-ProteinID: XP_005683099
LinkDB
Position
7
AA seq 375 aa
MARVCLPCLLLLLLPPLLRVSADTTEPCELDDDDFRCVCNFTDPKPDWSSAVQCMVAVEV
EIRGGGHSLDQFLKGANTDPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLK
ELTLEDLEVTGPTPPAPLEATGPALTTLSLRNVSWATGGAWLGELQQWLKPGLRALNIAQ
AHSLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFPALQYLALRNAGMETPSG
VCAALAAARVQPQSLDLSHNSLRVTAPGATRCVWPSALSSLNLSFAGLEQVPKGLPPKLS
VLDLSCNKLSREPRRDELPEVNVLTLDGNPFLDPGALQHQDDPMISGVVPACARSALTMG
VSGTLALLQGARGFA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcgagagtgtgcttgccctgcctgctgctgctgctgctgccgccactgctgcgtgtg
tctgcggacacgacagagccctgcgagctggacgacgacgatttccgctgtgtctgcaac
ttcacggatccgaagcctgactggtctagcgccgttcagtgtatggttgccgtcgaggtg
gagatccgtggcggcggccacagcctggaccagtttctcaagggagccaacaccgacccg
aagcagtatgctgacacaatcaaggctctgcgcgttcggcgactcaagctgggcgctgca
caggttcctgctcagcttctggtcgccgttctgcgcgcgctcgggtactctcgtctcaag
gaactgacgcttgaggacctggaggtaactggcccaacgcccccggcgcctctggaagcc
actgggcctgcgctcaccaccctcagtctccgtaacgtgtcgtgggcaacaggaggtgcc
tggctcggcgaactgcagcagtggctcaagcctgggctcagggcgctgaacattgcccaa
gcacactcgcttgcctttccctgcgcagggctctccaccttcgaggcgctcaccacccta
gacctgtctgacaatcccagtctcggcgacagcgggctgatggcggctctctgtccgaac
aagttcccggccctccaatatctagcgctacgcaacgcggggatggagacgccgagcggc
gtgtgcgcggcgctggcggcagcgagggtgcagccccaaagcctggacctcagccacaac
tcgctgcgcgtcaccgccccgggcgctacccgatgtgtctggcccagtgcactaagctct
ctcaatttgtcgttcgctgggctggagcaagtgcctaaaggactgccgcccaagctcagc
gtgcttgatctcagctgcaacaagctaagcagggagccgcggcgagacgagctgcccgag
gtaaatgtcctgactctggacggaaatccctttctggaccctggagccctccagcaccaa
gacgacccgatgatctccggcgtggtcccagcctgtgcgcgttcggccttgaccatgggg
gtatcaggaaccctggcgctgcttcaaggagcccgaggcttcgcgtaa

DBGET integrated database retrieval system