KEGG   Capra hircus (goat): 100861232
Entry
100861232         CDS       T02910                                 

Gene name
TNF, Cachectin, TNF-a, TNF-alpha, TNFA, TNFSF2
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
chx  Capra hircus (goat)
Pathway
chx01523  Antifolate resistance
chx04010  MAPK signaling pathway
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04064  NF-kappa B signaling pathway
chx04071  Sphingolipid signaling pathway
chx04150  mTOR signaling pathway
chx04210  Apoptosis
chx04217  Necroptosis
chx04350  TGF-beta signaling pathway
chx04380  Osteoclast differentiation
chx04612  Antigen processing and presentation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04640  Hematopoietic cell lineage
chx04650  Natural killer cell mediated cytotoxicity
chx04657  IL-17 signaling pathway
chx04660  T cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04668  TNF signaling pathway
chx04920  Adipocytokine signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04940  Type I diabetes mellitus
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05144  Malaria
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05205  Proteoglycans in cancer
chx05310  Asthma
chx05321  Inflammatory bowel disease
chx05322  Systemic lupus erythematosus
chx05323  Rheumatoid arthritis
chx05330  Allograft rejection
chx05332  Graft-versus-host disease
chx05410  Hypertrophic cardiomyopathy
chx05414  Dilated cardiomyopathy
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861232 (TNF)
   04350 TGF-beta signaling pathway
    100861232 (TNF)
   04064 NF-kappa B signaling pathway
    100861232 (TNF)
   04668 TNF signaling pathway
    100861232 (TNF)
   04071 Sphingolipid signaling pathway
    100861232 (TNF)
   04150 mTOR signaling pathway
    100861232 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100861232 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100861232 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100861232 (TNF)
   04217 Necroptosis
    100861232 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100861232 (TNF)
   04620 Toll-like receptor signaling pathway
    100861232 (TNF)
   04621 NOD-like receptor signaling pathway
    100861232 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100861232 (TNF)
   04625 C-type lectin receptor signaling pathway
    100861232 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100861232 (TNF)
   04612 Antigen processing and presentation
    100861232 (TNF)
   04660 T cell receptor signaling pathway
    100861232 (TNF)
   04657 IL-17 signaling pathway
    100861232 (TNF)
   04664 Fc epsilon RI signaling pathway
    100861232 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100861232 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100861232 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100861232 (TNF)
  09163 Immune disease
   05310 Asthma
    100861232 (TNF)
   05322 Systemic lupus erythematosus
    100861232 (TNF)
   05323 Rheumatoid arthritis
    100861232 (TNF)
   05321 Inflammatory bowel disease
    100861232 (TNF)
   05330 Allograft rejection
    100861232 (TNF)
   05332 Graft-versus-host disease
    100861232 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100861232 (TNF)
   05014 Amyotrophic lateral sclerosis
    100861232 (TNF)
   05020 Prion disease
    100861232 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100861232 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100861232 (TNF)
   05410 Hypertrophic cardiomyopathy
    100861232 (TNF)
   05414 Dilated cardiomyopathy
    100861232 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100861232 (TNF)
   04940 Type I diabetes mellitus
    100861232 (TNF)
   04932 Non-alcoholic fatty liver disease
    100861232 (TNF)
   04931 Insulin resistance
    100861232 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100861232 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100861232 (TNF)
   05135 Yersinia infection
    100861232 (TNF)
   05133 Pertussis
    100861232 (TNF)
   05134 Legionellosis
    100861232 (TNF)
   05152 Tuberculosis
    100861232 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100861232 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100861232 (TNF)
   05161 Hepatitis B
    100861232 (TNF)
   05160 Hepatitis C
    100861232 (TNF)
   05171 Coronavirus disease - COVID-19
    100861232 (TNF)
   05164 Influenza A
    100861232 (TNF)
   05168 Herpes simplex virus 1 infection
    100861232 (TNF)
   05163 Human cytomegalovirus infection
    100861232 (TNF)
   05169 Epstein-Barr virus infection
    100861232 (TNF)
   05165 Human papillomavirus infection
    100861232 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100861232 (TNF)
   05144 Malaria
    100861232 (TNF)
   05145 Toxoplasmosis
    100861232 (TNF)
   05140 Leishmaniasis
    100861232 (TNF)
   05142 Chagas disease
    100861232 (TNF)
   05143 African trypanosomiasis
    100861232 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100861232 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100861232 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    100861232 (TNF)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Tumor necrosis fators
   100861232 (TNF)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Cytokines
   100861232 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100861232
NCBI-ProteinID: NP_001273371
UniProt: P13296
LinkDB
Position
23
AA seq 234 aa
MSTKSMIRDVELAEEVLSKKAGGPQGSRSCWCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQSPAGPSFNRPLVQTLRSSSQASSNKPVAHVVANISAPGQLRWGDSYANALKANGVEL
KDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHR
ETPEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINQPEYLDYAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcaccaaaagcatgatccgggatgtggagctggcagaggaggtgctctccaagaaa
gcagggggcccccagggctccagaagttgctggtgcctcagcctcttctccttcctcctg
gttgcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg
gaagagcagtccccagccggcccctccttcaacaggcctctggttcagacactcaggtca
tcttctcaagcctcaagtaacaagccggtagcccacgttgtagccaacatcagcgctccg
gggcagctccggtggggggactcgtatgccaatgccctcaaggccaacggcgtggagctg
aaagacaaccagctggtggtgcccactgacgggctttacctcatctactcgcaggtcctc
ttcaggggccacggctgcccttccacccccttgttcctcacccacaccatcagccgcatt
gcagtctcctaccagaccaaggtcaacatcctctctgccatcaagagcccttgccacagg
gagaccccagagggggctgaggccaagccctggtacgaacccatctaccagggaggggtc
ttccagctggagaagggagatcgcctcagtgctgagatcaaccagccggaatacctggac
tatgctgagtctgggcaggtctactttgggatcatcgccctgtga

DBGET integrated database retrieval system