KEGG   Capra hircus (goat): 100861234
Entry
100861234         CDS       T02910                                 

Gene name
EIF4EBP1, 4E-BP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx03013  RNA transport
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04218  Cellular senescence
chx04910  Insulin signaling pathway
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05168  Herpes simplex virus 1 infection
chx05221  Acute myeloid leukemia
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100861234 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100861234 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100861234 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100861234 (EIF4EBP1)
   04152 AMPK signaling pathway
    100861234 (EIF4EBP1)
   04150 mTOR signaling pathway
    100861234 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100861234 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100861234 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100861234 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100861234 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100861234 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100861234 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100861234 (EIF4EBP1)
   05165 Human papillomavirus infection
    100861234 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100861234 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chx03019]
    100861234 (EIF4EBP1)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100861234 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100861234
NCBI-ProteinID: NP_001272518
UniProt: G1JSG2
LinkDB
Position
27
AA seq 118 aa
MSGGSSCSQTPSRAIPTARRVVLADGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPTGDEPPTEASQNHLRSSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccggaggtagcagctgcagccagaccccgagccgggccatccccaccgctcggagg
gtggtcctcgccgacggcgtgcagctgccccccggggactacagcaccacccccggcggc
acgcttttcagcaccacccccggaggtaccaggatcatctatgaccggaagttcctgatg
gagtgtcggaactcacctgtgaccaagacgcccccgcgggacctgcccaccattcccggg
gtcactagccctacaggcgatgagccccccacggaagccagccagaatcacctgcgcagc
agcccggaggacaagccggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system