KEGG   Capra hircus (goat): 100861292
Entry
100861292         CDS       T02910                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04260  Cardiac muscle contraction
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04742  Taste transduction
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04921  Oxytocin signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04927  Cortisol synthesis and secretion
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05410  Hypertrophic cardiomyopathy
chx05412  Arrhythmogenic right ventricular cardiomyopathy
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861292 (CACNA1C)
   04020 Calcium signaling pathway
    100861292 (CACNA1C)
   04024 cAMP signaling pathway
    100861292 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100861292 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100861292 (CACNA1C)
   04929 GnRH secretion
    100861292 (CACNA1C)
   04912 GnRH signaling pathway
    100861292 (CACNA1C)
   04921 Oxytocin signaling pathway
    100861292 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100861292 (CACNA1C)
   04924 Renin secretion
    100861292 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100861292 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100861292 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100861292 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100861292 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100861292 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100861292 (CACNA1C)
   04727 GABAergic synapse
    100861292 (CACNA1C)
   04725 Cholinergic synapse
    100861292 (CACNA1C)
   04728 Dopaminergic synapse
    100861292 (CACNA1C)
   04726 Serotonergic synapse
    100861292 (CACNA1C)
   04720 Long-term potentiation
    100861292 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100861292 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100861292 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100861292 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100861292 (CACNA1C)
   05020 Prion disease
    100861292 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100861292 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100861292 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100861292 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100861292 (CACNA1C)
   05414 Dilated cardiomyopathy
    100861292 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100861292 (CACNA1C)
   04934 Cushing syndrome
    100861292 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:chx04040]
    100861292 (CACNA1C)
Ion channels [BR:chx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100861292 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100861292
NCBI-ProteinID: XP_017904180
LinkDB
Position
5
AA seq 2166 aa
MVNENTRMYIPEENHQGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSATATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEMVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNENEDKSSYPNQ
ETAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDS
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSVIDVILSETNHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQ
AGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYPS
DGRGAFPQTFTTQRPLHISKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANN
TALGRCPRPAVHSGAVSTLEARGPPLSPAIRVQEASWRHSSQRCPSRDSPIAMLCQEEAP
GDETCAVHVDEDAEHSSEPSLVSTEMLSYQDDENRQLTPPKEDRRDVRLSPKRGFLRSAS
LGRRASFHLECLKRQKNPGGDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHPPGTLLPPR
LTPPATPGPAWPLRPVPTLRLEGAESSDKLTSSFPSIHCDPHVGEPTPCGVVGTPRRARP
VSLTVPSPAGPQGRPFHGSASSLVEAVLISEGLGQFAQDPRFLEATTQELADACDMTIEE
MESAADDILSGGAGQSPNGTLLPCANCRDPGPDRAGGVEDAAWAPSAEPRQGAEEPRDSR
AFASGL
NT seq 6501 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccggaggagaaccaccaaggtcccagctat
gggagcccgcgcccggctcacgccaacatgaatgccaacgcggccgcggggctggcgccc
gagcacatccccacgccgggggccgccctgtcctggcaggccgccatcgacgcggcccgg
caggccaagctgatgggcagtgctggcaacgcgaccatctccacggtcagctccacgcag
cggaagcggcagcagtacggaaagcccaagaagcagggcagcgcgacggccacccgcccg
ccccgcgccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatc
gtcgagtggaagccatttgaaatcattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattcccttcccagaggacgactccaacgccacgaattccaacctggag
cgggtggagtatctctttctcatcatttttactgtggaagcatttttaaaagtcatagcc
tacggactcctctttcaccccaacgcttacctccgcaatggctggaacttactagacttt
atcatcgtggttgtcgggcttttcagcgcgatcttagagcaagcgaccaaagccgatggg
gccaatgccctgggagggaagggtgctggattcgacgtgaaggccctgagggcattccgt
gtgctgcggcccctgcggttggtgtccggggtcccaagtctccaggtggtcctgaattcc
atcatcaaggccatggtgcccctgctgcacatcgccctgctcgtgcttttcgtcatcatc
atctacgccatcatcggcctggagctgttcatgggcaagatgcataagacctgctacaac
caggagggcattgccgatgtcccagcagaagacgacccctcaccctgtgccctggagacg
ggccacgggcggcaatgccagaacggcacagtgtgcaaaccaggctgggatgggcccaag
cacggcatcaccaatttcgacaacttcgccttcgccatgctgactgtgttccagtgcatc
accatggagggctggaccgacgtcctctactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgtcacattaatcatcataggttcattctttgttcttaacttggtt
ctcggtgtccttagcggagagttctccaaagagcgagagaaggccaaggcccggggcgac
ttccagaagctgcgagagaagcagcagctggaggaggacctgaagggctacctggactgg
atcacgcaggctgaggacatcgaccctgagaatgaggacgagggcctggatgaggagaaa
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacaccgaaaacgtggct
ggaggggacatcgagggagagagctgcggggccaggctggcccaccggatctccaagtcg
aagttcagccgctactggcgccggtggaatcggttctgcaggaggaagtgccgtgctgcc
gtgaagtccagcatcttctactggctggtcatcttcctggttttcctcaacacgctcacc
atcgcctccgagcactacaaccagccccactggctcacggaagtccaagacacggccaac
aaggcgctgctggccctgttcacggcggagatgctgctcaagatgtacagcctgggcctg
caggcctacttcgtgtcgctcttcaaccgcttcgactgcttcatcgtgtgcggcggcatc
ctggagaccatcctggtggagaccaagatcatgtcgcccttgggcatctccgtgctgcgc
tgcgtgcgcctcctgcggatatttaagatcacaaggtactggaactccctgagcaacctg
gtggcgtccctgctgaactcagtgcgctccattgcctcgctgctgctgctgctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggggggaagttcaactttgat
gagatgcagacccggaggagcaccttcgacaacttcccacagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaacgtgttcttggccattgccgtggacaacctggctgacgccgag
agcctcacgtctgcccagaaggaggaggaagaggagaaggagaggaagaagctagccagg
accgccagcccagagaagaagcaagagatggtagagaagccggccgtggaagagaccaag
gaggagaaaatcgagttgaaatccatcacggcagatggagagtccccacccgccaccaag
atcaacatggatgatctccagcccaatgagaatgaggacaagagttcctaccccaaccag
gaaactgcaggagaagaggatgaggaggagcccgagatgcccgtgggcccccgcccacgc
cccctctctgagctgcacctgaaggagaaggcagtgcccatgccggaagccagcgccttc
ttcatcttcagccccagtaacaggttccgcctccagtgccatcgcatcgtcaatgactcc
atcttcaccaacctgatcctcttcttcatcctgctcagcagcatctccctggccgccgag
gaccccgtgcagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgagattgccctgaagatgacggcctacggggccttcctgcac
aagggctccttctgccgcaactacttcaacatcctggacctgctggtggtcagtgtgtcc
ctcatctccttcggcatccagtccagtgccatcaacgtggtgaagatcctgcgagtcctg
agggtgctccggccactgcgggccatcaacagggccaaggggctgaagcacgtcgtgcag
tgcgtgttcgtggccatccgcaccatcgggaacattgtgattgtcaccacgctgctccag
ttcatgttcgcctgcattggggtccagctcttcaagggaaagctctacacctgttcggac
agttccaaacagacagaggctgaatgcaaggggaactacatcacatacaaggatggggag
gtagatcaccccatcatccagccccgcagctgggagaacagcaagttcgactttgacaat
gtcctggctgccatgatggccctgttcaccgtctccaccttcgagggatggccagagttg
ctgtaccgctccatcgactctcacacggaggacaagggtcccatatacaactaccgcgtg
gagatctccgtcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaagagtacaagaactgc
gagctggacaagaaccagcggcagtgtgtggagtatgccctcaaggcccggcccctgcgg
aggtacatcccgaaaaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgttctcattctgctcaacaccatctgcctggccatgcagcac
tacggtcagagctgtctgttcaaaatcgccatgaacatcctcaacatgctcttcaccggc
ctcttcacagtggagatggtcctgaagctcatcgccttcaagcccaagggctactttagt
gacccctggaatgtctttgacttcctgatcgtaattggcagcgtaattgacgtcattctc
agtgagacgaatcactatttctgtgatgcatggaacacatttgacgccttgattgttgtg
ggtagcattgttgatatagccatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcggaggagaactctcgcatctccatcaccttcttccgcctcttccgg
gtcatgcgtctcgtcaagctgctgagccgcggggagggcatccggacacttctgtggacc
ttcatcaagtcctttcaggccctaccctatgtggccctcctgatcgtgatgctgtttttc
atctacgccgtgatcgggatgcaggtgtttgggaaaatcgccctgaatgacacaacagag
atcaacaggaacaacaacttccagaccttcccccaggccgtgctgctcctcttcaggtgc
gccactggggaggcctggcaggacatcatgctggcctgcatgcctggcaagaagtgcgcc
cccgagtcagagccgggcaacagcacggagggggagacgccctgtggcagcagcttcgcc
gtcttctacttcatcagcttctacatgctctgcgccttcctgatcatcaacctcttcgta
gccgtcatcatggacaactttgactacctgacgagggactggtccatcctgggtccccac
cacctggacgaatttaagagaatttgggcagaatatgaccctgaagccaagggacgcatc
aagcacctggatgtggtgaccctgctccggcggattcagccccccctgggttttgggaag
ctgtgccctcaccgtgtggcttgcaaacggctggtctccatgaacatgcccctgaacagc
gacggaaccgtcatgttcaacgccacactgtttgccctggtccggacagccctgaggatc
aagacggaagggaacctggaacaggccaatgaggagctgcgggccatcatcaagaaaatc
tggaaacggactagcatgaagctgctggaccaagtggtgccgcctgcaggagatgacgag
gtcacagtgggcaagttttacgctactttcctgatccaagagtattttcggaagttcaag
aagcgcaaagagcaaggcctggtgggcaagccctcccagaggaatgccctgtccctgcag
gctggcctgcgcaccctgcacgacctggggcctgagatccgccgggccatctctggggac
ctgaccgccgaggaggagctggacaaggccatgaaggaggctgtgtctgcagcctcagaa
gatgacatcttcaggagggccgggggcctgttcggcaaccacgtgggctactaccccagt
gatggccggggcgccttcccccagaccttcaccacccagcgccccctgcacataagcaag
gcaggcaacagccagggggacaccgagtccccttcccacgagaagctggtggactccacc
ttcacccccagcagctactcatccacaggctccaacgccaacatcaacaacgccaacaac
accgccctgggccgctgcccccgccccgctgtccactctggtgctgtcagcaccttggaa
gcccgcgggccccccttgtcccctgccatccgggtgcaggaggcctcatggaggcacagc
tcccagaggtgcccctcccgggacagcccaatagccatgctgtgtcaggaagaggcccct
ggggacgagacctgtgccgtgcacgtggacgaggacgcagagcacagcagcgagcccagc
ctggtctccacggagatgctctcctaccaggatgacgagaatcggcagctgactcccccc
aaggaggacaggagggacgtccgtctgtccccaaagaggggcttcctgcgctccgcctcc
ctaggtcgaagggcctccttccaccttgaatgtctgaagcgacagaagaatcccggggga
gacgtctctcagaagacagtcctgcctttgcacctggttcaccatcaggcgctggcagtg
gcgggcctgagccccctcctgcagagaagccatccccccgggaccctcctcccaccacgc
ctcacaccccctgccacacctggcccagcctggcctctgcggcctgtgcccaccctgcgg
ctggagggggccgagtccagcgacaagctcaccagcagcttcccatccatccactgcgac
ccccacgtcggggagcccacgccctgcggggtcgtcggcaccccccggagggcccggccc
gtgtcactcactgtgcccagcccggcagggccccagggccggccgttccacggcagtgcc
agcagcctggtagaggcggtcttgatctcggaaggattggggcagtttgctcaggacccc
aggttcctcgaggccaccacgcaggagctggccgacgcctgcgacatgaccatcgaggag
atggagagcgcagccgacgacatcctcagtgggggcgccgggcagagccccaatggcacc
ctgctcccgtgtgcaaactgcagggacccggggccggaccgagcggggggcgtggaggac
gcagcctgggcgcccagcgccgagccccgccagggcgcagaggagccccgggacagcagg
gccttcgccagcggcctgtag

DBGET integrated database retrieval system