KEGG   Capra hircus (goat): 100861297
Entry
100861297         CDS       T02910                                 

Gene name
RPS6KB1, S6K1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04350  TGF-beta signaling pathway
chx04371  Apelin signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04714  Thermogenesis
chx04910  Insulin signaling pathway
chx04931  Insulin resistance
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100861297 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100861297 (RPS6KB1)
   04371 Apelin signaling pathway
    100861297 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100861297 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100861297 (RPS6KB1)
   04152 AMPK signaling pathway
    100861297 (RPS6KB1)
   04150 mTOR signaling pathway
    100861297 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100861297 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100861297 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100861297 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100861297 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100861297 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100861297 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861297 (RPS6KB1)
   05205 Proteoglycans in cancer
    100861297 (RPS6KB1)
   05231 Choline metabolism in cancer
    100861297 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100861297 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100861297 (RPS6KB1)
   05212 Pancreatic cancer
    100861297 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100861297 (RPS6KB1)
   05226 Gastric cancer
    100861297 (RPS6KB1)
   05221 Acute myeloid leukemia
    100861297 (RPS6KB1)
   05224 Breast cancer
    100861297 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100861297 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100861297 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100861297 (RPS6KB1)
   05165 Human papillomavirus infection
    100861297 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100861297 (RPS6KB1)
   01522 Endocrine resistance
    100861297 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100861297 (RPS6KB1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100861297 (RPS6KB1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100861297 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100861297
NCBI-ProteinID: NP_001272570
UniProt: D1MGL7
LinkDB
Position
19
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPERFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLGGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggtttctacccggcgccggacttccgagacagggaa
gctgaggacatggcaggggtgtttgacatagacctggaccagccggaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaacgttttgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcctttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcggcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcacgtcaaactaacagattttggactatgc
aaagaatctattcatgacggaacagtcacacacaccttttgtggaacaatagaatacatg
gcccctgagatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaacgaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggaaggtggagccccccttcaaacctcttttgcaatcagaagaggatgtgagt
cagtttgattccaagtttacacgtcagacacctgttgacagcccagatgactcagctctc
agtgaaagtgccaaccaggtctttctgggttttacgtatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcccctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatccgcagacgcctgtggaataccccatggagacaagtggg
atagagcagatggacgtgacaatgagcggggaggcttcagcaccgcttccaatacgacag
ccaaactccggaccgtacaaaaagcaagcttttcccatgatctccaaacgaccagagcac
ctgcgtatgaatctatga

KEGG   Capra hircus (goat): 102169319
Entry
102169319         CDS       T02910                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04350  TGF-beta signaling pathway
chx04371  Apelin signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04714  Thermogenesis
chx04910  Insulin signaling pathway
chx04931  Insulin resistance
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102169319
   04350 TGF-beta signaling pathway
    102169319
   04371 Apelin signaling pathway
    102169319
   04066 HIF-1 signaling pathway
    102169319
   04151 PI3K-Akt signaling pathway
    102169319
   04152 AMPK signaling pathway
    102169319
   04150 mTOR signaling pathway
    102169319
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102169319
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102169319
  09152 Endocrine system
   04910 Insulin signaling pathway
    102169319
  09149 Aging
   04211 Longevity regulating pathway
    102169319
   04213 Longevity regulating pathway - multiple species
    102169319
  09159 Environmental adaptation
   04714 Thermogenesis
    102169319
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169319
   05205 Proteoglycans in cancer
    102169319
   05231 Choline metabolism in cancer
    102169319
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102169319
  09162 Cancer: specific types
   05210 Colorectal cancer
    102169319
   05212 Pancreatic cancer
    102169319
   05225 Hepatocellular carcinoma
    102169319
   05226 Gastric cancer
    102169319
   05221 Acute myeloid leukemia
    102169319
   05224 Breast cancer
    102169319
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102169319
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102169319
   05163 Human cytomegalovirus infection
    102169319
   05165 Human papillomavirus infection
    102169319
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102169319
   01522 Endocrine resistance
    102169319
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102169319
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102169319
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102169319
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 102169319
NCBI-ProteinID: XP_017914512
LinkDB
Position
15
AA seq 498 aa
MRRRRRRDGFCPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETRVNRGPEKIRPECSELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFTVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLYQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPADAGEVQAHPFFRHINWEEL
LARRVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPI
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggtttctgcccagcgccggacttccgagacagggaa
gctgaggacatggcaggggtgtttgacatagacctggaccagccggaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactcgtgtgaac
agagggccagaaaaaatcagaccagaatgttctgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaaggaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcctttcactgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttatatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcacgtcaaactaacagattttggactatgc
aaagaatctattcatgacggaacagtcacacacaccttttgtggaacaatagaatacatg
gcccctgagatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
gcggatgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggagggtggagccccccttcaaacctcttttgcaatcagaagaggatgtgagt
cagtttgattccaagtttacacgtcagacacctgttgacagcccagatgactcagctctc
agtgaaagtgccaaccaggtctttctgggttttacgtatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcccctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatccgcagacgcctgtggaataccccatggagacaagtggg
atagagcagatggacgtgacaatgagcggggaggcttcagcaccgcttccaatatga

KEGG   Capra hircus (goat): 102182675
Entry
102182675         CDS       T02910                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04350  TGF-beta signaling pathway
chx04371  Apelin signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04714  Thermogenesis
chx04910  Insulin signaling pathway
chx04931  Insulin resistance
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05221  Acute myeloid leukemia
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102182675 (RPS6KB2)
   04350 TGF-beta signaling pathway
    102182675 (RPS6KB2)
   04371 Apelin signaling pathway
    102182675 (RPS6KB2)
   04066 HIF-1 signaling pathway
    102182675 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    102182675 (RPS6KB2)
   04152 AMPK signaling pathway
    102182675 (RPS6KB2)
   04150 mTOR signaling pathway
    102182675 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102182675 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102182675 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102182675 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    102182675 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    102182675 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102182675 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102182675 (RPS6KB2)
   05205 Proteoglycans in cancer
    102182675 (RPS6KB2)
   05231 Choline metabolism in cancer
    102182675 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102182675 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102182675 (RPS6KB2)
   05212 Pancreatic cancer
    102182675 (RPS6KB2)
   05225 Hepatocellular carcinoma
    102182675 (RPS6KB2)
   05226 Gastric cancer
    102182675 (RPS6KB2)
   05221 Acute myeloid leukemia
    102182675 (RPS6KB2)
   05224 Breast cancer
    102182675 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102182675 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102182675 (RPS6KB2)
   05163 Human cytomegalovirus infection
    102182675 (RPS6KB2)
   05165 Human papillomavirus infection
    102182675 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102182675 (RPS6KB2)
   01522 Endocrine resistance
    102182675 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102182675 (RPS6KB2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102182675 (RPS6KB2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102182675 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C FeoB_C
Other DBs
NCBI-GeneID: 102182675
NCBI-ProteinID: XP_017898400
LinkDB
Position
29
AA seq 432 aa
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTESSVNPGPE
RIGPHCFELLRVLGKGNYGKVFQVRKVQGSNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGHIKLTDFGLCKESIHEGAVTHTFCGTI
EYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPPYLT
PDARDLVKKFLKRNPNQRIGGGPGDAADVQRHPFFRHVNWDDLLARRVDPPFRPSLQSEE
DVSQFDSHFTRQTPVDSPDDTTLSESANQAFLGFTYVAPSVLDSIKEAFSFQPKLRSPRR
LNSSPRTPVSPLKFSPFEGFRPSPGPQELVEAPLPPLLPPPPPPPPSSTAPLPIRPPSGT
KKSKRGRGRPGR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctgcggtgtttgacctggacctggagacagaggaaggcagcgaaggcgagggcgag
ccagagctcagccccgcggacgcgtgtcccctcgcggagttgagggcggctggcctggag
cctgtgggacactatgaggaggtggagctgactgagagcagtgtgaacccgggccccgag
cgcatcggtccccactgctttgagctgctgcgtgtgctgggcaaggggaactatggcaag
gtgttccaggtgcgaaaggtacagggcagcaatctgggcaaaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgcgcaacgccaaggacacggcacacacgcgggctgagcgg
aacattctggagtcggtgaagcaccctttcattgtggaactggcctatgccttccagact
ggcggcaaactttacctcatcctcgagtgcctcagcggccacatcaaactgacggacttt
ggcctctgcaaggagtcgatccacgagggcgctgtgacccacaccttctgcggcaccatc
gagtacatggcgcctgagattctggtgcgcagtggccacaaccgggcagtggactggtgg
agcttgggggccctgatgtacgacatgctcactggatcgccgcccttcactgcagagaac
cggaagaaaaccatggacaagatcatcagagggaagctggagctgcccccctacctcacc
ccggatgcccgggatctcgtcaaaaagttcttgaagcggaatcctaaccagcggattgga
gggggccccggggatgctgctgatgtgcagaggcaccccttcttccggcacgttaattgg
gatgacctcctggcccgccgtgtggacccccctttccggccttccctgcaatcggaggag
gacgtgagccagtttgactcccacttcacaaggcagacaccagtggacagtccagatgac
acaacgctcagtgagagtgccaaccaggccttcctgggcttcacgtacgtggcgccctcc
gtcctggacagcatcaaggaggccttctccttccagcccaagctgcgctcgcccaggcgc
ctcaacagcagtccccggacccctgtcagccccctgaagttctcgcccttcgaggggttc
cggcccagccccggcccacaggagctcgtagaggccccgctacctcctctgctgccaccg
ccgccaccaccaccgccctccagcaccgcccccctccctatccgacccccctcagggacc
aaaaagtccaagaggggccgtgggcgccctgggcgctaa

DBGET integrated database retrieval system