KEGG   Capra hircus (goat): 100861300
Entry
100861300         CDS       T02910                                 

Gene name
TGFBR2, TGF-BETARII
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04060  Cytokine-cytokine receptor interaction
chx04068  FoxO signaling pathway
chx04144  Endocytosis
chx04218  Cellular senescence
chx04350  TGF-beta signaling pathway
chx04380  Osteoclast differentiation
chx04390  Hippo signaling pathway
chx04520  Adherens junction
chx04659  Th17 cell differentiation
chx04926  Relaxin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05142  Chagas disease
chx05161  Hepatitis B
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05220  Chronic myeloid leukemia
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861300 (TGFBR2)
   04350 TGF-beta signaling pathway
    100861300 (TGFBR2)
   04390 Hippo signaling pathway
    100861300 (TGFBR2)
   04068 FoxO signaling pathway
    100861300 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100861300 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100861300 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100861300 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100861300 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100861300 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100861300 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100861300 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861300 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100861300 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100861300 (TGFBR2)
   05212 Pancreatic cancer
    100861300 (TGFBR2)
   05225 Hepatocellular carcinoma
    100861300 (TGFBR2)
   05226 Gastric cancer
    100861300 (TGFBR2)
   05220 Chronic myeloid leukemia
    100861300 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100861300 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100861300 (TGFBR2)
   05161 Hepatitis B
    100861300 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100861300 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100861300 (TGFBR2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100861300 (TGFBR2)
Protein kinases [BR:chx01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100861300 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100861300
NCBI-ProteinID: XP_017922706
LinkDB
Position
22
AA seq 567 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDLMVTDHNGAIKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASPK
CIMKERKGSGETFFMCSCSAEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAI
AVIVIFYCYRIHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETXAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDSVLRDRGRPEIPSSWLNHQGIQMVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgacctgatggtcactgat
cacaacggtgccatcaagctgtcgcagctgtgtaagttctgcgacgtgcgatcgtccacc
tgcgacaaccagaagtcctgctggagcaactgcagcatcacggccatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacactggagacggtc
tgccacgaccccaagattgcctaccatggatttgtcctggacgatgctgcttctccaaag
tgtatcatgaaggaaagaaaggggtccggagagactttcttcatgtgctcctgcagcgct
gaagagtgcaatgaccacatcatcttctccgaagagtacaccagcagtaaccctgacttg
ctgctggtcatcttccaagtgacaggcgtcagcctcctgccaccgctgggcatcgccatc
gcagtcatcgtcattttctactgctaccgcatccaccggcagcagaagctgagcccagcc
tgggactcgggcaagccgcgcaagctgatggagttcagcgagcacctggccatcatcctg
gaggacgaccgctccgacatcagctccacctgcgccaacaatatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaggcagaacacgtctgagcagttcgagacgntggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctaacggccgaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgccggctgggcggctcactggcccgcggcatcgcgcac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgcgacttcgggctc
tcactgcggctggaccccaccctgtcggtagatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaatgtcgag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgccgtgggagaagtgaaggactacgagcctccgttcgggtcgaaggtgcgggag
cacccctgcgtggagagcatgaaggacagcgtgctgagagaccggggccggccagagatc
cccagctcctggctcaaccaccagggcatccagatggtgtgcgagacgctggccgagtgc
tgggaccatgaccccgaggcccggctcacagcgcagtgcgtggccgagcgcttcagcgag
ctggagcacctggacaggctctcggggaggagcagctcggaggagaagatccccgaagac
ggctccctcaacactaccaaatag

DBGET integrated database retrieval system