KEGG   Capra hircus (goat): 102168229
Entry
102168229         CDS       T02910                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
chx  Capra hircus (goat)
Pathway
chx04152  AMPK signaling pathway
chx04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102168229 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102168229 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102168229 (EEF2K)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102168229 (EEF2K)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   102168229 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1 DUF1771
Other DBs
NCBI-GeneID: 102168229
NCBI-ProteinID: XP_017896094
UniProt: A0A452E2Z6
LinkDB
Position
25
AA seq 722 aa
MAEEDLIFRLEGVDGGPASRAGDSDTDSDDDEEGYFICSITDDPGAHQNVNFKVNCHSNL
AKSERYGSSGSPAGSFHFKEAWKHAIEKAKHMPDPWAEFHLEDVATECATRHRYNAVTGE
WVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDVYFE
DVRLQMEAKLWGEEYNRHKPPKQVDIMQMCVIELKERPGRPLFHLEHYIEGKYIKYNSNS
GFVRDDNVRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTERGTDFGDGNLGVR
GMALFFHSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSPRVR
TLSGSRPPLLLRLSENSGDDNMSDVTFDSLPSSPSSATPQSQKLDHLHWPVFSDLDNMAP
RDQDPLDNHRDSENSGDSGYPSEKRGDLDDPEPREHGHSNGNRRYESDEDSLGSSGRVCV
EKWNLFNSSRLHLPRPSAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEAGRFCEKD
EEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEANKTKGFDYLLK
AAEAGDRQCMILVARAFDTGQNLSPDRSQSWPEALHWYNTALETTDCDEGGEYDGMQDEP
RYMLLAREAEMLFTGGCGLEKDPQRSGDLYTQAAEAAIEAMKGRLANQYYEKAEEAWAQM
EE
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggccgaggaagacctcatcttccgcctggaaggcgtggatggcggcccagcctcccgg
gctggtgattcagacacagacagcgacgatgatgaggagggttacttcatctgctccatc
accgatgaccccggggcacaccagaatgtcaacttcaaggttaactgccacagcaaccta
gcaaagagcgagcgctacggctccagtgggtccccggccggctccttccatttcaaggaa
gcttggaagcatgcaatcgagaaagccaagcacatgcctgacccctgggctgagttccac
ctggaagacgttgccacagaatgcgccacgcgccacaggtacaacgctgtcaccggcgag
tgggtggaggatgaagtcctaatcaagatggcgtctcagcccttcggccggggagcaatg
agggagtgcttcaggacgaagaagctctccaacttcctgcacacccagcagtggaagggg
gcctccaactacgtggcaaagcgctacatcgagtccgtggacagggatgtgtacttcgag
gacgtgcgtctacagatggaggccaagctctggggagaggagtataatcggcacaagccc
cccaagcaggtggacatcatgcagatgtgcgtcatagagctgaaggagagaccgggccgg
ccgctgttccacctggaacactacatcgagggcaagtacatcaagtacaactccaactca
ggcttcgtccgtgatgacaacgtgcgcctaacgccgcaggccttcagccacttcacgttt
gagcgttccggccaccagctgattgtggtggacatccagggtgtgggtgatctctacact
gacccacagatccacactgagaggggcactgactttggagatggaaatctaggtgtccgt
gggatggccctcttcttccactcgcatgcctgcaaccggatttgcaagagcatgggcctc
gctccctttgacctgtccccaagagagagggatgcagtgaatcagaacaccaagctgctg
cagtcagccaagaccatcttaaggggtacagaggaaaagtgtgggagcccgcgggtgagg
accctctcagggagccggccccccctgctccttcgcctctcagagaactctggagatgac
aacatgagtgacgtgacctttgactctctcccttcctcgccgtcttcagccacgccacag
agccagaaactggaccacctccattggcctgtgttcagcgacctcgataacatggcacct
cgagaccaggaccctctggacaaccaccgggactctgagaacagtggggacagtggatac
cccagtgagaagcggggtgacctggatgacccagagcccagagaacatggccactcaaac
ggtaaccggaggtacgagtcggatgaagacagcctgggcagctccggacgggtctgtgtg
gagaagtggaatctcttcaactcctcccgcctccacctgccgagaccttcagctgtggcc
ctggaagtgcagaggctcaacgctctggacctcgagaagaaaatcgggaagtccattttg
gggaaggtccatctggccatggtgcgctaccacgaggccggccgcttctgtgagaaggac
gaggagtgggaccgggagtcggcagtcttccacctggagcatgcagccgacctgggcgag
ctggaggccatcgtgggcctgggactcatgtactcgcagctgccccaccacatcctggca
gatgtctctctgaaggagacagaagcgaacaaaaccaaaggatttgattacttactgaag
gcagccgaagctggtgacaggcagtgcatgattctggtggcgcgagcctttgacactggc
cagaacctcagccctgacaggtcccagagctggccagaggctctccactggtacaacact
gccctggagacaactgactgtgatgagggtggggagtatgatgggatgcaagacgaaccc
cggtacatgctgctggccagggaggcggagatgctgttcacaggcggctgcgggctggag
aaggacccacagagatcaggtgacttgtacacccaggcagccgaggcagcgatagaagcc
atgaagggccggctggccaaccagtactacgagaaagcagaggaggcctgggcccagatg
gaggaataa

DBGET integrated database retrieval system