KEGG   Capra hircus (goat): 102168391
Entry
102168391         CDS       T02910                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102168391 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102168391 (PIK3CA)
   04014 Ras signaling pathway
    102168391 (PIK3CA)
   04015 Rap1 signaling pathway
    102168391 (PIK3CA)
   04370 VEGF signaling pathway
    102168391 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102168391 (PIK3CA)
   04668 TNF signaling pathway
    102168391 (PIK3CA)
   04066 HIF-1 signaling pathway
    102168391 (PIK3CA)
   04068 FoxO signaling pathway
    102168391 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102168391 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102168391 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102168391 (PIK3CA)
   04024 cAMP signaling pathway
    102168391 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102168391 (PIK3CA)
   04152 AMPK signaling pathway
    102168391 (PIK3CA)
   04150 mTOR signaling pathway
    102168391 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102168391 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102168391 (PIK3CA)
   04218 Cellular senescence
    102168391 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102168391 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102168391 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102168391 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102168391 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102168391 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102168391 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102168391 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102168391 (PIK3CA)
   04660 T cell receptor signaling pathway
    102168391 (PIK3CA)
   04662 B cell receptor signaling pathway
    102168391 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102168391 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102168391 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102168391 (PIK3CA)
   04062 Chemokine signaling pathway
    102168391 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102168391 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102168391 (PIK3CA)
   04929 GnRH secretion
    102168391 (PIK3CA)
   04915 Estrogen signaling pathway
    102168391 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102168391 (PIK3CA)
   04917 Prolactin signaling pathway
    102168391 (PIK3CA)
   04926 Relaxin signaling pathway
    102168391 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102168391 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102168391 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102168391 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102168391 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102168391 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102168391 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102168391 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102168391 (PIK3CA)
   04380 Osteoclast differentiation
    102168391 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102168391 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102168391 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102168391 (PIK3CA)
   05206 MicroRNAs in cancer
    102168391 (PIK3CA)
   05205 Proteoglycans in cancer
    102168391 (PIK3CA)
   05203 Viral carcinogenesis
    102168391 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102168391 (PIK3CA)
   05231 Choline metabolism in cancer
    102168391 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102168391 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102168391 (PIK3CA)
   05212 Pancreatic cancer
    102168391 (PIK3CA)
   05225 Hepatocellular carcinoma
    102168391 (PIK3CA)
   05226 Gastric cancer
    102168391 (PIK3CA)
   05214 Glioma
    102168391 (PIK3CA)
   05221 Acute myeloid leukemia
    102168391 (PIK3CA)
   05220 Chronic myeloid leukemia
    102168391 (PIK3CA)
   05218 Melanoma
    102168391 (PIK3CA)
   05211 Renal cell carcinoma
    102168391 (PIK3CA)
   05215 Prostate cancer
    102168391 (PIK3CA)
   05213 Endometrial cancer
    102168391 (PIK3CA)
   05224 Breast cancer
    102168391 (PIK3CA)
   05222 Small cell lung cancer
    102168391 (PIK3CA)
   05223 Non-small cell lung cancer
    102168391 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102168391 (PIK3CA)
   05017 Spinocerebellar ataxia
    102168391 (PIK3CA)
   05020 Prion disease
    102168391 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102168391 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102168391 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102168391 (PIK3CA)
   04931 Insulin resistance
    102168391 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102168391 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102168391 (PIK3CA)
   05135 Yersinia infection
    102168391 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102168391 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102168391 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102168391 (PIK3CA)
   05161 Hepatitis B
    102168391 (PIK3CA)
   05160 Hepatitis C
    102168391 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102168391 (PIK3CA)
   05164 Influenza A
    102168391 (PIK3CA)
   05162 Measles
    102168391 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102168391 (PIK3CA)
   05163 Human cytomegalovirus infection
    102168391 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102168391 (PIK3CA)
   05169 Epstein-Barr virus infection
    102168391 (PIK3CA)
   05165 Human papillomavirus infection
    102168391 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102168391 (PIK3CA)
   05142 Chagas disease
    102168391 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102168391 (PIK3CA)
   01524 Platinum drug resistance
    102168391 (PIK3CA)
   01522 Endocrine resistance
    102168391 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102168391 (PIK3CA)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102168391 (PIK3CA)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102168391 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102168391
NCBI-ProteinID: XP_005675346
UniProt: A0A452EUC1
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttgaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtatgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcgtattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaactggtccgta
tcccgtgaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtactaaag
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcgttaactaat
caaaggatcggtcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatctgaag
caccttaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctccagggctttctgtctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaggatatgctaacccttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggatgtctgtca
attggtgattgtgtgggacttattgaggtggtgagaaattctcacactataatgcagatt
cagtgtaaaggaggcctgaaaggtgcactgcagttcaacagccacacactccatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccatcgatttgtttacacggtca
tgtgctggatattgtgttgcaaccttcatcttgggaattggagatcgtcacaatagtaat
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Capra hircus (goat): 102170135
Entry
102170135         CDS       T02910                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102170135 (PIK3R2)
   04014 Ras signaling pathway
    102170135 (PIK3R2)
   04015 Rap1 signaling pathway
    102170135 (PIK3R2)
   04370 VEGF signaling pathway
    102170135 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102170135 (PIK3R2)
   04668 TNF signaling pathway
    102170135 (PIK3R2)
   04066 HIF-1 signaling pathway
    102170135 (PIK3R2)
   04068 FoxO signaling pathway
    102170135 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102170135 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102170135 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102170135 (PIK3R2)
   04024 cAMP signaling pathway
    102170135 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102170135 (PIK3R2)
   04152 AMPK signaling pathway
    102170135 (PIK3R2)
   04150 mTOR signaling pathway
    102170135 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102170135 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102170135 (PIK3R2)
   04218 Cellular senescence
    102170135 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102170135 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102170135 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102170135 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102170135 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102170135 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102170135 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102170135 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102170135 (PIK3R2)
   04660 T cell receptor signaling pathway
    102170135 (PIK3R2)
   04662 B cell receptor signaling pathway
    102170135 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102170135 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102170135 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102170135 (PIK3R2)
   04062 Chemokine signaling pathway
    102170135 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102170135 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102170135 (PIK3R2)
   04929 GnRH secretion
    102170135 (PIK3R2)
   04915 Estrogen signaling pathway
    102170135 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102170135 (PIK3R2)
   04917 Prolactin signaling pathway
    102170135 (PIK3R2)
   04926 Relaxin signaling pathway
    102170135 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102170135 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102170135 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102170135 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102170135 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102170135 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102170135 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102170135 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102170135 (PIK3R2)
   04380 Osteoclast differentiation
    102170135 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102170135 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102170135 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102170135 (PIK3R2)
   05206 MicroRNAs in cancer
    102170135 (PIK3R2)
   05205 Proteoglycans in cancer
    102170135 (PIK3R2)
   05203 Viral carcinogenesis
    102170135 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102170135 (PIK3R2)
   05231 Choline metabolism in cancer
    102170135 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102170135 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102170135 (PIK3R2)
   05212 Pancreatic cancer
    102170135 (PIK3R2)
   05225 Hepatocellular carcinoma
    102170135 (PIK3R2)
   05226 Gastric cancer
    102170135 (PIK3R2)
   05214 Glioma
    102170135 (PIK3R2)
   05221 Acute myeloid leukemia
    102170135 (PIK3R2)
   05220 Chronic myeloid leukemia
    102170135 (PIK3R2)
   05218 Melanoma
    102170135 (PIK3R2)
   05211 Renal cell carcinoma
    102170135 (PIK3R2)
   05215 Prostate cancer
    102170135 (PIK3R2)
   05213 Endometrial cancer
    102170135 (PIK3R2)
   05224 Breast cancer
    102170135 (PIK3R2)
   05222 Small cell lung cancer
    102170135 (PIK3R2)
   05223 Non-small cell lung cancer
    102170135 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102170135 (PIK3R2)
   05017 Spinocerebellar ataxia
    102170135 (PIK3R2)
   05020 Prion disease
    102170135 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102170135 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102170135 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102170135 (PIK3R2)
   04931 Insulin resistance
    102170135 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102170135 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102170135 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102170135 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102170135 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102170135 (PIK3R2)
   05161 Hepatitis B
    102170135 (PIK3R2)
   05160 Hepatitis C
    102170135 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102170135 (PIK3R2)
   05164 Influenza A
    102170135 (PIK3R2)
   05162 Measles
    102170135 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102170135 (PIK3R2)
   05163 Human cytomegalovirus infection
    102170135 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102170135 (PIK3R2)
   05169 Epstein-Barr virus infection
    102170135 (PIK3R2)
   05165 Human papillomavirus infection
    102170135 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102170135 (PIK3R2)
   05142 Chagas disease
    102170135 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102170135 (PIK3R2)
   01524 Platinum drug resistance
    102170135 (PIK3R2)
   01522 Endocrine resistance
    102170135 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102170135 (PIK3R2)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102170135 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 102170135
NCBI-ProteinID: XP_017906913
LinkDB
Position
7
AA seq 776 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPAGPFCSSSTTWPI
TQGGPTGPGLPLLCARASPPRAKAASNGGCADRERLNTKGLTLPDLPEQFSPPDVAPPIL
VKLVEAIERTGLDSYRPEPPTMRTDWSLGDVEQWDAAALSEGVKSFLLALPAPLVTPEAA
AEAHRALREAAGPVGPALEPPTLPLHHALTLRFLLQHLGRVARRAPAPGPAVRALGATFG
PLLLRAPPPPSPPPGGAPDGAEPTPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKTKPA
PTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKG
GNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQ
IVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFE
EQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASD
NREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYSLMEDED
DLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYR
TATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPAAR
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggctggccctgagggcttccaataccgtgcattgtacccattccgccgggagcggccg
gaggacctggagctacttccgggtgatgtgctggtggtgagcagggccgccctgcaggcg
ctgggcgtggccgagggcaacgagcgctgcccgcagagcgtcggctggatgcctggcctc
aatgagcgtacccggcaacgcggtgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcctggccctcgcccacgtggcccccgcccactgcccgccaggccc
cgagacgggccccctgagccagctgggcctttctgcagctcaagcaccacctggcccatc
actcagggaggccccacaggccctggcttgcccctgctgtgtgccagggcgtccccgcca
agggccaaagctgcatcaaatggtggctgtgccgacagagagcgcctgaacacaaaaggc
ctgacactccctgacctacccgagcagttctccccccctgatgtggctccccctatcctg
gtgaagctggtggaggccattgaacggacagggttggacagctacaggcctgagccaccc
accatgcgcacagactggtccctgggtgatgtggagcagtgggatgcggcagccctgtca
gagggtgtgaaaagcttcctgctggcgctgccggcgcccctcgtgacacccgaggccgcg
gccgaggcacaccgagccctgcgggaggctgcggggcccgtggggccggcgctggagccc
ccgacgctgccactgcaccacgcgctcacgctgcgcttcctgctccagcacctgggccgg
gtggccaggcgcgccccagccccgggccccgcggtccgtgccctgggcgccaccttcggg
ccgctgctgctgcgcgcgccgccgccgccctctccgccgccagggggcgcgcccgacggg
gccgagcccacccccgactttcctgcgctgctggtggagaagctgcttcaggaacacctg
gaggagcaggaggttgcccccccagcactgccaccaaaaccccccaagacaaagccagcc
cccacaggcctggccaatgggggcagcccaccctccctgcaagatgccgagtggtactgg
ggtgacatctccagggaggaggtaaacgagaaactgcgggacacgcccgacggcaccttc
ctggtccgagatgcctccagcaagatccagggagagtacacgctgaccctcaggaagggc
ggaaacaacaagctgatcaaggtcttccaccgagacgggcactacggcttctcggagccg
ctcaccttctgctctgtcgtggacctcatcacccactaccgccatgagtcactggcccag
tacaacgccaagctggacacgcggctcctctacccggtgtccaagtaccaacaggaccag
atcgtcaaggaggacagcgtggaggcggtgggtgcccagctcaaggtctaccaccagcag
taccaggacaagagccgcgagtacgaccagctctacgaggagtacacgcgcacctcccag
gaactgcagatgaagcgcacagccatcgaagccttcaatgagaccatcaagatctttgaa
gagcagggccagacgcaggagaagtgcagcaaggagtatctggagcgcttccgacgtgag
ggcaatgagaaagaaatgcagaggatcctgctcaactcggagcggctcaagtctcgcatt
gctgagatccatgagagccgcacaaagctggagcaggagctgcgggcacaggcctctgac
aaccgagagatcgacaagcgcatgaacagcctcaagccagacctcatgcagttgcgcaag
atccgagaccagtaccttgtgtggctcactcagaaaggtgcccggcagaagaaaatcaac
gaatggttggggatcaagaacgagactgaggaccagtactcactgatggaggatgaggat
gacctcccccaccacgaggaacgcacatggtatgtaggcaagatcaaccgcacccaagct
gaggaaatgctgagtggcaagcgggacggtaccttcctcatccgtgagagcagccagcgg
ggttgctacgcctgttctgtggtggtggacggcgataccaagcactgcgtcatctaccgc
acggccacgggcttcggcttcgcggagccctacaacctgtacgggtccctgaaggagctc
gtcctccactaccagcacgcctccctggtgcagcacaatgacgcgctgaccgtcacgctc
gctcaccccgtgcgcgcccccgggcctgggcccccgcccgctgctcgctga

KEGG   Capra hircus (goat): 102177551
Entry
102177551         CDS       T02910                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102177551 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102177551 (PIK3CD)
   04014 Ras signaling pathway
    102177551 (PIK3CD)
   04015 Rap1 signaling pathway
    102177551 (PIK3CD)
   04370 VEGF signaling pathway
    102177551 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102177551 (PIK3CD)
   04668 TNF signaling pathway
    102177551 (PIK3CD)
   04066 HIF-1 signaling pathway
    102177551 (PIK3CD)
   04068 FoxO signaling pathway
    102177551 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102177551 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102177551 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102177551 (PIK3CD)
   04024 cAMP signaling pathway
    102177551 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102177551 (PIK3CD)
   04152 AMPK signaling pathway
    102177551 (PIK3CD)
   04150 mTOR signaling pathway
    102177551 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102177551 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102177551 (PIK3CD)
   04218 Cellular senescence
    102177551 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102177551 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102177551 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102177551 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102177551 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102177551 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102177551 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102177551 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102177551 (PIK3CD)
   04660 T cell receptor signaling pathway
    102177551 (PIK3CD)
   04662 B cell receptor signaling pathway
    102177551 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102177551 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102177551 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102177551 (PIK3CD)
   04062 Chemokine signaling pathway
    102177551 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102177551 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102177551 (PIK3CD)
   04929 GnRH secretion
    102177551 (PIK3CD)
   04915 Estrogen signaling pathway
    102177551 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102177551 (PIK3CD)
   04917 Prolactin signaling pathway
    102177551 (PIK3CD)
   04926 Relaxin signaling pathway
    102177551 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102177551 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102177551 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102177551 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102177551 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102177551 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102177551 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102177551 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102177551 (PIK3CD)
   04380 Osteoclast differentiation
    102177551 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102177551 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102177551 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102177551 (PIK3CD)
   05206 MicroRNAs in cancer
    102177551 (PIK3CD)
   05205 Proteoglycans in cancer
    102177551 (PIK3CD)
   05203 Viral carcinogenesis
    102177551 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102177551 (PIK3CD)
   05231 Choline metabolism in cancer
    102177551 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102177551 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102177551 (PIK3CD)
   05212 Pancreatic cancer
    102177551 (PIK3CD)
   05225 Hepatocellular carcinoma
    102177551 (PIK3CD)
   05226 Gastric cancer
    102177551 (PIK3CD)
   05214 Glioma
    102177551 (PIK3CD)
   05221 Acute myeloid leukemia
    102177551 (PIK3CD)
   05220 Chronic myeloid leukemia
    102177551 (PIK3CD)
   05218 Melanoma
    102177551 (PIK3CD)
   05211 Renal cell carcinoma
    102177551 (PIK3CD)
   05215 Prostate cancer
    102177551 (PIK3CD)
   05213 Endometrial cancer
    102177551 (PIK3CD)
   05224 Breast cancer
    102177551 (PIK3CD)
   05222 Small cell lung cancer
    102177551 (PIK3CD)
   05223 Non-small cell lung cancer
    102177551 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102177551 (PIK3CD)
   05017 Spinocerebellar ataxia
    102177551 (PIK3CD)
   05020 Prion disease
    102177551 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102177551 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102177551 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102177551 (PIK3CD)
   04931 Insulin resistance
    102177551 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102177551 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102177551 (PIK3CD)
   05135 Yersinia infection
    102177551 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102177551 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102177551 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102177551 (PIK3CD)
   05161 Hepatitis B
    102177551 (PIK3CD)
   05160 Hepatitis C
    102177551 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102177551 (PIK3CD)
   05164 Influenza A
    102177551 (PIK3CD)
   05162 Measles
    102177551 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102177551 (PIK3CD)
   05163 Human cytomegalovirus infection
    102177551 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102177551 (PIK3CD)
   05169 Epstein-Barr virus infection
    102177551 (PIK3CD)
   05165 Human papillomavirus infection
    102177551 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102177551 (PIK3CD)
   05142 Chagas disease
    102177551 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102177551 (PIK3CD)
   01524 Platinum drug resistance
    102177551 (PIK3CD)
   01522 Endocrine resistance
    102177551 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102177551 (PIK3CD)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102177551 (PIK3CD)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102177551 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102177551
NCBI-ProteinID: XP_017915865
UniProt: A0A452FD91
LinkDB
Position
16
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRIPSRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAP
HPVYYPSLDKILELGRLGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRRIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVCSQKTPKPHAKEMMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ETAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaatgtg
gcagttgatttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaaggtgttatggcaccgcgcccagtatgagccgctcttccac
atgctcagtgaccctgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgcctgtcctgcgg
ctggtggcccgcgaaggtgaccgcgtgaagaagctcatcaactcgcagatcagcctgctc
attggcaaaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
ggcaagatgcgccagttctgcgaggaggcggctgcccgcaggcagcagctgggctgggag
gcctggctgcagtacagcttccctctgcagttggagccctcagcgcggagctgggggccg
ggcaccctgcgcatccccagtcgggccctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtatccaccaaggatgtgcccctggcactgatggcctgcgcc
ctccgaaagaaggccacggtgttccggcagccgctggtggagcagcctgaggactacaca
ctgcaggtgaacggcaagcatgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagtgggctgaccccccacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgagcagagcaaccctgccccccaagtccagaagccacgc
accaaaccgccccccatccccatgaagaagccctcctccgtgtccctctggtccctggag
cagcctttctacatcgagctgatccagggcagcaaagtgaatgccgacgaacggatgaag
ctggtggtgcaggccgggctcttccatggcaatgagacactatgcaagacggtgtccagc
tcagaggtgagcgtatgttcggagcccgtgtggaagcagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccggctctgcttcgcgctttacgccgtgatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacgggcgagcgctgtctctac
atgtggccctctgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgcgg
agtaaccccaacactgagagtgcagccgccttggtcatctttctccccgaggtggcccct
caccctgtatactacccttccctggacaagatcctggagctggggcggcttggagagcat
ggacgcttcacggaggaggagcagctgcagctgcgggagatcctggagcggcggggttct
ggggaactgtacgagcacgagaaggacctggtgtggaagatgcgacacgagatccaggag
cactttcccgaggctctagcccggctgctgctggtcactaagtggaacaaacacgaggac
gtggcccagatgctctacctgctctgctcctggcctgaactgcccgttctgagcgccctg
gagttgctagacttcagcttccccgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactaacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaggatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gctctgcgattcggcctcatcatggaagcctattgccggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctcaatgacttcgtcaaa
gtgtgctcccagaagacccccaaaccccacgccaaggagatgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacttgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaaacccctgtgg
gtcatgtacagcaacgaggaggcaggcagcgatggcaccgtgggcatcatctttaagaat
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggagggcttggacctgaggatgaccccctacggctgcctctccactggggac
cgcacaggccttattgaggtggtgcttcactcggacaccattgccaacatccagctgaac
aagagcaacatggcggccacggccgccttcaataaggatgctctgctcaactggctcaag
tccaagaacccgggggaggccctggaccgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacctatgtgctgggcatcggcgatcgccacagcgacaacatcatg
atccgagagaacgggcagctgttccacattgatttcggccattttctggggaatttcaag
accaagtttggaatcaaccgtgagcgggtcccgttcatcctcacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaagtttgaaaggttccggggctattgt
gagacggcctacaccatcctgcggcgccatgggctccttttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggcattggggaaaacggaggaggaggctctgaagcacttccgagtgaagtttaat
gaagccctccgggaaagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaataa

KEGG   Capra hircus (goat): 102179343
Entry
102179343         CDS       T02910                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102179343 (PIK3R3)
   04014 Ras signaling pathway
    102179343 (PIK3R3)
   04015 Rap1 signaling pathway
    102179343 (PIK3R3)
   04370 VEGF signaling pathway
    102179343 (PIK3R3)
   04630 JAK-STAT signaling pathway
    102179343 (PIK3R3)
   04668 TNF signaling pathway
    102179343 (PIK3R3)
   04066 HIF-1 signaling pathway
    102179343 (PIK3R3)
   04068 FoxO signaling pathway
    102179343 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    102179343 (PIK3R3)
   04072 Phospholipase D signaling pathway
    102179343 (PIK3R3)
   04071 Sphingolipid signaling pathway
    102179343 (PIK3R3)
   04024 cAMP signaling pathway
    102179343 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    102179343 (PIK3R3)
   04152 AMPK signaling pathway
    102179343 (PIK3R3)
   04150 mTOR signaling pathway
    102179343 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102179343 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    102179343 (PIK3R3)
   04218 Cellular senescence
    102179343 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102179343 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102179343 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102179343 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102179343 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    102179343 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    102179343 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    102179343 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    102179343 (PIK3R3)
   04660 T cell receptor signaling pathway
    102179343 (PIK3R3)
   04662 B cell receptor signaling pathway
    102179343 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    102179343 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    102179343 (PIK3R3)
   04670 Leukocyte transendothelial migration
    102179343 (PIK3R3)
   04062 Chemokine signaling pathway
    102179343 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102179343 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    102179343 (PIK3R3)
   04929 GnRH secretion
    102179343 (PIK3R3)
   04915 Estrogen signaling pathway
    102179343 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    102179343 (PIK3R3)
   04917 Prolactin signaling pathway
    102179343 (PIK3R3)
   04926 Relaxin signaling pathway
    102179343 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    102179343 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    102179343 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102179343 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102179343 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    102179343 (PIK3R3)
   04722 Neurotrophin signaling pathway
    102179343 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102179343 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    102179343 (PIK3R3)
   04380 Osteoclast differentiation
    102179343 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    102179343 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    102179343 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102179343 (PIK3R3)
   05206 MicroRNAs in cancer
    102179343 (PIK3R3)
   05205 Proteoglycans in cancer
    102179343 (PIK3R3)
   05203 Viral carcinogenesis
    102179343 (PIK3R3)
   05230 Central carbon metabolism in cancer
    102179343 (PIK3R3)
   05231 Choline metabolism in cancer
    102179343 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102179343 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102179343 (PIK3R3)
   05212 Pancreatic cancer
    102179343 (PIK3R3)
   05225 Hepatocellular carcinoma
    102179343 (PIK3R3)
   05226 Gastric cancer
    102179343 (PIK3R3)
   05214 Glioma
    102179343 (PIK3R3)
   05221 Acute myeloid leukemia
    102179343 (PIK3R3)
   05220 Chronic myeloid leukemia
    102179343 (PIK3R3)
   05218 Melanoma
    102179343 (PIK3R3)
   05211 Renal cell carcinoma
    102179343 (PIK3R3)
   05215 Prostate cancer
    102179343 (PIK3R3)
   05213 Endometrial cancer
    102179343 (PIK3R3)
   05224 Breast cancer
    102179343 (PIK3R3)
   05222 Small cell lung cancer
    102179343 (PIK3R3)
   05223 Non-small cell lung cancer
    102179343 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102179343 (PIK3R3)
   05017 Spinocerebellar ataxia
    102179343 (PIK3R3)
   05020 Prion disease
    102179343 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102179343 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102179343 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    102179343 (PIK3R3)
   04931 Insulin resistance
    102179343 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102179343 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102179343 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    102179343 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102179343 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    102179343 (PIK3R3)
   05161 Hepatitis B
    102179343 (PIK3R3)
   05160 Hepatitis C
    102179343 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    102179343 (PIK3R3)
   05164 Influenza A
    102179343 (PIK3R3)
   05162 Measles
    102179343 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    102179343 (PIK3R3)
   05163 Human cytomegalovirus infection
    102179343 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102179343 (PIK3R3)
   05169 Epstein-Barr virus infection
    102179343 (PIK3R3)
   05165 Human papillomavirus infection
    102179343 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102179343 (PIK3R3)
   05142 Chagas disease
    102179343 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102179343 (PIK3R3)
   01524 Platinum drug resistance
    102179343 (PIK3R3)
   01522 Endocrine resistance
    102179343 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102179343 (PIK3R3)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102179343 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Cupin_8 Fez1 DUF5638
Other DBs
NCBI-GeneID: 102179343
NCBI-ProteinID: XP_005678577
UniProt: A0A452ET07
LinkDB
Position
3
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFISEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccattacaaatggaataaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtcagagatgcctcaaccaaaatgcagggagattac
actttgaccttgcggaagggaggcaataataagctaataaagatttatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattagccactat
catcatgaatctcttgcccagtacaatcccaaacttgatgtgaaactgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagacaatattgatgccgtcggtaaaaaa
ctgcaggagtatcactctcagtatcaggaaaagagtaaagaatatgacagactatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcatacacaagaacaacatagcaaagaatat
attgagcgatttcgaaaagaagggaatgaaaaggaaattgaacgaattatgatgaattat
gacaagttgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctcgaacaggat
ttgaagaaacaagctttggataaccgagaaatagacaaaaaaatgaatagtatcaaacct
gacctgatccagctgcgcaagatcagagatcagcaccttgtgtggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcagtgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaaccgagtacaagcagaggacttgctttatgggaaacctgacggtgcattc
ttaatccgtgagagtagcaagaaaggatgttatgcttgctctgtggtcgccgacggagag
gtgaagcactgcgtcatctacagcactgctcggggctacggcttcgcagagccctacaac
ctgtacagctccctgaaggagctggtgctccactaccagcagacgtccctcgtgcagcac
aacgactctctcaacgtcaggctcgcctaccctgtccacgcacagatgccctcgctctgc
agataa

KEGG   Capra hircus (goat): 102185042
Entry
102185042         CDS       T02910                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102185042 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102185042 (PIK3CB)
   04014 Ras signaling pathway
    102185042 (PIK3CB)
   04015 Rap1 signaling pathway
    102185042 (PIK3CB)
   04370 VEGF signaling pathway
    102185042 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102185042 (PIK3CB)
   04668 TNF signaling pathway
    102185042 (PIK3CB)
   04066 HIF-1 signaling pathway
    102185042 (PIK3CB)
   04068 FoxO signaling pathway
    102185042 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102185042 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102185042 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102185042 (PIK3CB)
   04024 cAMP signaling pathway
    102185042 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102185042 (PIK3CB)
   04152 AMPK signaling pathway
    102185042 (PIK3CB)
   04150 mTOR signaling pathway
    102185042 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102185042 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102185042 (PIK3CB)
   04218 Cellular senescence
    102185042 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102185042 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102185042 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102185042 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102185042 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102185042 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102185042 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102185042 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102185042 (PIK3CB)
   04660 T cell receptor signaling pathway
    102185042 (PIK3CB)
   04662 B cell receptor signaling pathway
    102185042 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102185042 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102185042 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102185042 (PIK3CB)
   04062 Chemokine signaling pathway
    102185042 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102185042 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102185042 (PIK3CB)
   04929 GnRH secretion
    102185042 (PIK3CB)
   04915 Estrogen signaling pathway
    102185042 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102185042 (PIK3CB)
   04917 Prolactin signaling pathway
    102185042 (PIK3CB)
   04926 Relaxin signaling pathway
    102185042 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102185042 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102185042 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102185042 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102185042 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102185042 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102185042 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102185042 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102185042 (PIK3CB)
   04380 Osteoclast differentiation
    102185042 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102185042 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102185042 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185042 (PIK3CB)
   05206 MicroRNAs in cancer
    102185042 (PIK3CB)
   05205 Proteoglycans in cancer
    102185042 (PIK3CB)
   05203 Viral carcinogenesis
    102185042 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102185042 (PIK3CB)
   05231 Choline metabolism in cancer
    102185042 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102185042 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102185042 (PIK3CB)
   05212 Pancreatic cancer
    102185042 (PIK3CB)
   05225 Hepatocellular carcinoma
    102185042 (PIK3CB)
   05226 Gastric cancer
    102185042 (PIK3CB)
   05214 Glioma
    102185042 (PIK3CB)
   05221 Acute myeloid leukemia
    102185042 (PIK3CB)
   05220 Chronic myeloid leukemia
    102185042 (PIK3CB)
   05218 Melanoma
    102185042 (PIK3CB)
   05211 Renal cell carcinoma
    102185042 (PIK3CB)
   05215 Prostate cancer
    102185042 (PIK3CB)
   05213 Endometrial cancer
    102185042 (PIK3CB)
   05224 Breast cancer
    102185042 (PIK3CB)
   05222 Small cell lung cancer
    102185042 (PIK3CB)
   05223 Non-small cell lung cancer
    102185042 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102185042 (PIK3CB)
   05017 Spinocerebellar ataxia
    102185042 (PIK3CB)
   05020 Prion disease
    102185042 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102185042 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102185042 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102185042 (PIK3CB)
   04931 Insulin resistance
    102185042 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102185042 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102185042 (PIK3CB)
   05135 Yersinia infection
    102185042 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102185042 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185042 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102185042 (PIK3CB)
   05161 Hepatitis B
    102185042 (PIK3CB)
   05160 Hepatitis C
    102185042 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102185042 (PIK3CB)
   05164 Influenza A
    102185042 (PIK3CB)
   05162 Measles
    102185042 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102185042 (PIK3CB)
   05163 Human cytomegalovirus infection
    102185042 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102185042 (PIK3CB)
   05169 Epstein-Barr virus infection
    102185042 (PIK3CB)
   05165 Human papillomavirus infection
    102185042 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102185042 (PIK3CB)
   05142 Chagas disease
    102185042 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102185042 (PIK3CB)
   01524 Platinum drug resistance
    102185042 (PIK3CB)
   01522 Endocrine resistance
    102185042 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102185042 (PIK3CB)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102185042 (PIK3CB)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102185042 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102185042
NCBI-ProteinID: XP_017905388
UniProt: A0A452FAR7
LinkDB
Position
1
AA seq 1070 aa
MCFYFMMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttctacttcatgatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcatctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgagctt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctaactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cactcgctaattcagttccagtatatccggaactgtgtgatgaacagaacattgccccat
tttatacttgtggagtgttgcaagatcaagaagctgtatgaacaggaaatggttgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgttgtaagctcagagatatcagggaagaatgatcatatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatactacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccttattactatcctcccttcgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacacgcattgccgaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaattatccagatcagtatgtacga
gaatatgcggtgggctgcctacaacagatgagtgatgaagaactctctcagtatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccttgtctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcacctcagatct
gaagtacacattcctgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaagcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcatacttgtctaaaacagaatgcttaccgtgaagccctctctgacctgcagtca
cctctgaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtctggaccttcggatgctaccttatggc
tgcttagcaacaggagaccgttctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgccggcatgggaatctcttc
atcacgctgtttgcactgatgttgactgcagggcttcctgagctcacctcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtcaattggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Capra hircus (goat): 102188710
Entry
102188710         CDS       T02910                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05142  Chagas disease
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102188710 (PIK3R1)
   04014 Ras signaling pathway
    102188710 (PIK3R1)
   04015 Rap1 signaling pathway
    102188710 (PIK3R1)
   04370 VEGF signaling pathway
    102188710 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102188710 (PIK3R1)
   04668 TNF signaling pathway
    102188710 (PIK3R1)
   04066 HIF-1 signaling pathway
    102188710 (PIK3R1)
   04068 FoxO signaling pathway
    102188710 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102188710 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102188710 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102188710 (PIK3R1)
   04024 cAMP signaling pathway
    102188710 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102188710 (PIK3R1)
   04152 AMPK signaling pathway
    102188710 (PIK3R1)
   04150 mTOR signaling pathway
    102188710 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102188710 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102188710 (PIK3R1)
   04218 Cellular senescence
    102188710 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102188710 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102188710 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102188710 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188710 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102188710 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102188710 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102188710 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102188710 (PIK3R1)
   04660 T cell receptor signaling pathway
    102188710 (PIK3R1)
   04662 B cell receptor signaling pathway
    102188710 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102188710 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102188710 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102188710 (PIK3R1)
   04062 Chemokine signaling pathway
    102188710 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102188710 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102188710 (PIK3R1)
   04929 GnRH secretion
    102188710 (PIK3R1)
   04915 Estrogen signaling pathway
    102188710 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102188710 (PIK3R1)
   04917 Prolactin signaling pathway
    102188710 (PIK3R1)
   04926 Relaxin signaling pathway
    102188710 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102188710 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102188710 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102188710 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102188710 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102188710 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102188710 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102188710 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102188710 (PIK3R1)
   04380 Osteoclast differentiation
    102188710 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102188710 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102188710 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188710 (PIK3R1)
   05206 MicroRNAs in cancer
    102188710 (PIK3R1)
   05205 Proteoglycans in cancer
    102188710 (PIK3R1)
   05203 Viral carcinogenesis
    102188710 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102188710 (PIK3R1)
   05231 Choline metabolism in cancer
    102188710 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102188710 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102188710 (PIK3R1)
   05212 Pancreatic cancer
    102188710 (PIK3R1)
   05225 Hepatocellular carcinoma
    102188710 (PIK3R1)
   05226 Gastric cancer
    102188710 (PIK3R1)
   05214 Glioma
    102188710 (PIK3R1)
   05221 Acute myeloid leukemia
    102188710 (PIK3R1)
   05220 Chronic myeloid leukemia
    102188710 (PIK3R1)
   05218 Melanoma
    102188710 (PIK3R1)
   05211 Renal cell carcinoma
    102188710 (PIK3R1)
   05215 Prostate cancer
    102188710 (PIK3R1)
   05213 Endometrial cancer
    102188710 (PIK3R1)
   05224 Breast cancer
    102188710 (PIK3R1)
   05222 Small cell lung cancer
    102188710 (PIK3R1)
   05223 Non-small cell lung cancer
    102188710 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102188710 (PIK3R1)
   05017 Spinocerebellar ataxia
    102188710 (PIK3R1)
   05020 Prion disease
    102188710 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102188710 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102188710 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102188710 (PIK3R1)
   04931 Insulin resistance
    102188710 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188710 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102188710 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102188710 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188710 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102188710 (PIK3R1)
   05161 Hepatitis B
    102188710 (PIK3R1)
   05160 Hepatitis C
    102188710 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102188710 (PIK3R1)
   05164 Influenza A
    102188710 (PIK3R1)
   05162 Measles
    102188710 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102188710 (PIK3R1)
   05163 Human cytomegalovirus infection
    102188710 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102188710 (PIK3R1)
   05169 Epstein-Barr virus infection
    102188710 (PIK3R1)
   05165 Human papillomavirus infection
    102188710 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102188710 (PIK3R1)
   05142 Chagas disease
    102188710 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102188710 (PIK3R1)
   01524 Platinum drug resistance
    102188710 (PIK3R1)
   01522 Endocrine resistance
    102188710 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102188710 (PIK3R1)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102188710 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I
Other DBs
NCBI-GeneID: 102188710
NCBI-ProteinID: XP_005694665
UniProt: A0A452FGW5
LinkDB
Position
20
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQAATLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSSPAELRQLLDCDAASLDLEMFDVH
VLADTFKRYLVDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtaccgggcgctgtacgactataaaaaggagcgggaagaa
gacattgacttgcacctgggggacatattgactgtgaacaaagggtccttagtcgctctt
ggattcagtgatggacaggaagccaagcctgaagaaattggctggttaaatggctataac
gagacgacaggggagaggggagactttccgggaacttacgtagaatatattggaaggaaa
aagatctcgcctcccacaccaaagccccggccacctcgaccccttcctgttgccccaggt
ccttcaaaaactgaagccgacagtgagcaacaagctgccactctcccggaccttgcagag
cagttcgcaccccctgacgttgctccaccgcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcagcccagccgag
ttacgacagcttcttgattgtgatgccgcctccttggacctggagatgttcgatgtgcac
gttttagctgacaccttcaaacgctatctcgtggacttaccgaatcctgtcattccggta
gccgtttccagtgaactgatttctttagccccagaagtgcagagttctgaagaatacatc
cagctgttgaagaagctcattaggtcgcccagcatacctcatcagtactggctcacgcta
cagtatttgctaaaacatttcttcaagctctctcaaacgtccagcaaaaatcttttgaat
gcgagagtactttctgaactcttcagccctctgcttttcagattcccagcagcaagttct
gagaatactgaacacctcataaaaattatagaaatcttaatctccaccgaatggaatgaa
cgccagcctgcaccagcactgcctcccaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtctttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagctgacgggacctttttggtacgagacgca
tctactaaaatgcatggggattacactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaagactatacccgaacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagttcaaacgtgaaggcaatgagacggaa
atccaaaggattatgcataattacgaaaagttgaagtctcgaatcagtgaaattgtcgac
agcagaaggagattggaagaggacttgaagaagcaggcggctgagtatcgtgagattgac
aaacgcatgaacagcatcaaaccagacctcattcagctaagaaagacaagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaaattgaacgagtggctgggcaat
gaaaacactgaagaccaatattcactggtagaagatgatgaggatttgccccaccatgac
gagaagacttggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagacggcacttttcttgtccgggagagcagcaagcagggctgctacgcctgctct
gtggtggtggacggtgaggtcaagcactgcgtcatcaacaagacggccacgggctacggc
ttcgccgagccctacaacctgtacagctccctcaaggagctcgtgctccactaccagcac
acatccctcgtgcagcacaacgactccctgaacgtcacactagcctacccggtgtacgcg
cagcagaggcgatga

DBGET integrated database retrieval system