KEGG   Capra hircus (goat): 102169019
Entry
102169019         CDS       T02910                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04740  Olfactory transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102169019 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102169019 (ADCY3)
   04371 Apelin signaling pathway
    102169019 (ADCY3)
   04020 Calcium signaling pathway
    102169019 (ADCY3)
   04072 Phospholipase D signaling pathway
    102169019 (ADCY3)
   04024 cAMP signaling pathway
    102169019 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102169019 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102169019 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102169019 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102169019 (ADCY3)
   04062 Chemokine signaling pathway
    102169019 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102169019 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102169019 (ADCY3)
   04912 GnRH signaling pathway
    102169019 (ADCY3)
   04913 Ovarian steroidogenesis
    102169019 (ADCY3)
   04915 Estrogen signaling pathway
    102169019 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102169019 (ADCY3)
   04921 Oxytocin signaling pathway
    102169019 (ADCY3)
   04926 Relaxin signaling pathway
    102169019 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102169019 (ADCY3)
   04918 Thyroid hormone synthesis
    102169019 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102169019 (ADCY3)
   04916 Melanogenesis
    102169019 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102169019 (ADCY3)
   04927 Cortisol synthesis and secretion
    102169019 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102169019 (ADCY3)
   04270 Vascular smooth muscle contraction
    102169019 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102169019 (ADCY3)
   04971 Gastric acid secretion
    102169019 (ADCY3)
   04972 Pancreatic secretion
    102169019 (ADCY3)
   04976 Bile secretion
    102169019 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102169019 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102169019 (ADCY3)
   04727 GABAergic synapse
    102169019 (ADCY3)
   04725 Cholinergic synapse
    102169019 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102169019 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102169019 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102169019 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102169019 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102169019 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102169019 (ADCY3)
   04714 Thermogenesis
    102169019 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169019 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102169019 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102169019 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102169019 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102169019 (ADCY3)
   05163 Human cytomegalovirus infection
    102169019 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102169019 (ADCY3)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102169019 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 102169019
NCBI-ProteinID: XP_005687005
UniProt: A0A452G4N4
LinkDB
Position
11
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSADKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVRLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SSSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINVYAWRPIFDDYDHKRFQQHNFPMVALEKMQVFSTSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagcccgagtactccgctgagtactcggccgagtac
tctgtcagcctgccttcggaccctgaccgcggggtgggccggacccatgaaatctcagtt
cggaactcggggtcgtgcctctgcttacctcgcttcatgcgactgaccttcgtaccagag
tccttggagaatctgtaccagacttacttcaagaggcagcgccatgagaccctgctggtg
ctggtggtctttgcggccctcttcgactgctatgtggtggtcatgtgcgccgtggtcttc
tctgctgacaagctggcccccctcgccgtggccggggttgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccatgcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaagggagtg
cgcttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggacgagagc
cagaaagaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggtttcacccagctgtcctcagcctgcagtgcccaggagctt
gtgaagctgctcaatgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggtgactgctactactgcatctgcgggctgcctgactaccgg
gaggaccacgctgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggggtggacatgcgagtgggggtgcacacgggcaccgtg
ctggggggcgtcctcggccagaaacgctggcagtacgatgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagtttgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcattgagacctacctcatcatcgcttccaagccagaggtgaag
aagacagctgcccaaaacggcctcaacggctcggccctgctgaacggagcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcagctctatatctgaggagcccgaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggatgcctct
gaggacgagcatgagctcaaccagctactcaacgaggcactgctcgagcgagagtctgcc
caggtagtgaagaagagaaacaccttcctcctgtctatgcggttcatggaccctgagatg
gaaacccgctactcagtggagaaggagaagcagagcggggctgccttcagctgctcctgc
gttgtcctgctctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacgatctgctcactggct
gccatctttccacgggcctttcctaagaagctcgtggccttctctacttggatcgaccgg
acacgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggccctaccaacggcaccgcagag
atgcaggtggaggacggctgcgtggagaaccccaagtactacaactacgtggccgtgctg
tccctcatcgctaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggctgtggctgtcatcaacgtctacgcctggcgccccatctttgat
gactacgaccacaaacgcttccagcaacacaactttccaatggtggccttagagaagatg
caagtgttttccacctcgggactcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatcttcgtcatgatgctgagcttttactacttctcccgacac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaagccttggtcaccaacatgctgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgccgacttctacacagaggag
agcatcaataatggcggcattgagtgtctgcgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggcagacctggctgacttt
gcgctggccatgaaggacacgctcaccaacatcaataaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaatgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagagtatggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacgttccctaacggcgcctcaatcacactgcctcaccag
gtagtagacaactcctga

KEGG   Capra hircus (goat): 102169557
Entry
102169557         CDS       T02910                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102169557 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102169557 (ADCY6)
   04371 Apelin signaling pathway
    102169557 (ADCY6)
   04072 Phospholipase D signaling pathway
    102169557 (ADCY6)
   04024 cAMP signaling pathway
    102169557 (ADCY6)
   04022 cGMP-PKG signaling pathway
    102169557 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102169557 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102169557 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102169557 (ADCY6)
   04062 Chemokine signaling pathway
    102169557 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    102169557 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    102169557 (ADCY6)
   04912 GnRH signaling pathway
    102169557 (ADCY6)
   04913 Ovarian steroidogenesis
    102169557 (ADCY6)
   04915 Estrogen signaling pathway
    102169557 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    102169557 (ADCY6)
   04921 Oxytocin signaling pathway
    102169557 (ADCY6)
   04926 Relaxin signaling pathway
    102169557 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    102169557 (ADCY6)
   04918 Thyroid hormone synthesis
    102169557 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    102169557 (ADCY6)
   04916 Melanogenesis
    102169557 (ADCY6)
   04924 Renin secretion
    102169557 (ADCY6)
   04925 Aldosterone synthesis and secretion
    102169557 (ADCY6)
   04927 Cortisol synthesis and secretion
    102169557 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102169557 (ADCY6)
   04270 Vascular smooth muscle contraction
    102169557 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    102169557 (ADCY6)
   04971 Gastric acid secretion
    102169557 (ADCY6)
   04972 Pancreatic secretion
    102169557 (ADCY6)
   04976 Bile secretion
    102169557 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102169557 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102169557 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    102169557 (ADCY6)
   04727 GABAergic synapse
    102169557 (ADCY6)
   04725 Cholinergic synapse
    102169557 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    102169557 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    102169557 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    102169557 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    102169557 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    102169557 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102169557 (ADCY6)
   04714 Thermogenesis
    102169557 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169557 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    102169557 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102169557 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102169557 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102169557 (ADCY6)
   05163 Human cytomegalovirus infection
    102169557 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102169557 (ADCY6)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102169557 (ADCY6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 102169557
NCBI-ProteinID: XP_017903345
LinkDB
Position
5
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQQRPRRGTRTSGFCTPRYMSCLQGAQPPSPTPATAP
RCPWQDEAFIRRGGPGKGPELGLRAVALGFEDPEVAVAVGAAEAAPAVATRSRRACWRQL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAALVLLTAVLLAFHAAPARPQPAYVA
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLVLAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLVVFPRSALMLGIHAGIFLLLLVTVLTCAVYTCGS
LFPEALRRVSRSIVRSRAHSTAVGIFSVLLVFTSAVASMFTCNHTPIRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFIGNVLLSLLASSVFLHISSIGKLAMI
FVLGLVYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgtggtttagcggcctcttggtccccaaggtggatgaacggaaaacagcctggggg
gagcgcaatgggcagcagcggccgcgccgcgggacccgcaccagtggcttctgcacgccc
cgctacatgagctgcctccagggtgcgcagccgcccagcccaacccccgccactgcccct
cggtgcccctggcaggatgaggccttcatccggcggggcggcccaggcaagggcccggag
ctggggctgcgggcggtggccctgggcttcgaggaccctgaggtggccgtggccgtcgga
gcagcggaggcggcccccgccgtggccaccaggagcaggcgggcttgctggcgccagctg
gtgcaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgg
tacttcttccagatgaaccagagcagtctgacgctgctcatggcggcgctcgtgctgctc
acggccgtgctgctggccttccacgcagcgcccgcccgccctcagcccgcctatgtggcc
ctgctggcctgtgccgccaccctcttcgtggcactcatggtggtgtgcaaccgccacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcggccgtg
caggtcgggggcgccctggcagccgacccgcacagcccatctgcaggcctctggtgcccc
gtgttctttgtctacatcacctacacgctcctccctatccgcatgcgggccgctgtcttc
agcggcctgggcctctccaccctgcacttggtcttggcctggcagctcaaccgtggtgat
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaatgtcatt
gggatctgcacacactatccggctgaggtgtctcagcgccaggcatttcaagagacccgc
ggttacatccaggcccgcctgcacctgcagcatgagaaccggcagcaggagcggctgctg
ctgtctgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcataagatctacattcagaagcatgacaatgtcagcatcctgttt
gcagacattgaaggcttcaccagcctggcatcccagtgcacggcacaggagctggtcatg
accctgaatgagctctttgcccggttcgacaagctggctgcggaaaaccactgcctcagg
atcaagatcttaggggactgttactactgcgtgtcagggctgccagaggcccgggcagac
catgcccactgctgcgtggagatgggggtggacatgatcgaggctatctcgctggtgcgc
gaggtgacaggtgtaaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgc
ggtgtccttggcttgcggaaatggcagtttgacgtgtggtccaatgacgtgactctggcc
aaccacatggaggccgggggccgggctggccgcatccacatcacccgggccacactgcag
tacctgaatggggactatgaggtggagccgggccgtggtggggagcgcaacgcctacctc
aaggagcagcacattgagaccttcctcatcctaggagccagccagaaacggaaagaggag
aaggccatgctggccaagctacagcgggcgcgggccaactccatggaggggctgatgcca
cgctgggtgcctgaccgtgccttctcccggaccaaggactccaaggctttccgccagatg
ggcatcgatgattccagcaaagacaaccggggtgctcaggatgccctgaaccctgaggat
gaggtagacgagttcctgggccgggccattgatgcccgcagcatcgatcagctgcgcaag
gaccacgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactca
cgcaaggtggacccccgctttggagcctacgtggcctgtgccctgctggtcttctgcttc
atctgcttcatccagcttgtcgtcttcccacgctcagccctgatgcttggcatccacgcc
gggatcttcctgctgttactggtcactgtgctgacctgcgccgtgtacacctgtggctct
ctgttccctgaggccctgcgacgtgtgtctcgcagtatcgtccgctcgagggcacatagc
actgcagttggcatcttttctgtcctgcttgtgttcacctccgccgtcgccagcatgttc
acctgtaaccacacccccatacgaacttgtgcagcccggatgttgaatttaacccctgct
gacattaccgcctgccacctgcagcagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccccgagtacttcattgggaacgtgttgctg
agtctcttggccagctctgtcttcctgcacatcagtagtatcgggaagttggccatgatc
tttgtcctggggctcgtctatctggtgctgcttctgctgggtcccccagccaccatcttt
gacaactatgacctcctgctgggcgtccatggcttggcttcttccaatgagacctttgat
gggctggactgcccagcagccgggagggtggcactcaaatacatgacccccgtgattctg
ctggtgtttgcactggcgctgtacctgcatgcccagcaggtggagtccaccgcccgcctg
gacttcctctggaagctgcaggcaacaggggagaaggaggagatggaggagctccaggcc
tacaaccggcggctgctacataacattctgcccaaggatgtggccgcccatttcctggcc
cgggagcgccggaacgacgagctctactaccagtcctgtgaatgtgtggctgtcatgttc
gcctccattgccaacttctctgagttctacgtggagctggaggccaacaacgagggtgtc
gagtgcctgcgactgctcaatgagatcattgctgattttgatgagatcatcagtgaggag
cgcttccggcagctggagaagatcaagacaattggtagcacctacatggctgcctctggg
ctgaatgccagcacctatgatcaggtgggccgctcccacatcaccgccctcgctgactat
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagattggactgaacatgggcccagttgtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaacacagtgaatgtctcaagtcgaatggacagcaccggggtc
cccgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Capra hircus (goat): 102171922
Entry
102171922         CDS       T02910                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102171922 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102171922 (ADCY2)
   04371 Apelin signaling pathway
    102171922 (ADCY2)
   04020 Calcium signaling pathway
    102171922 (ADCY2)
   04072 Phospholipase D signaling pathway
    102171922 (ADCY2)
   04024 cAMP signaling pathway
    102171922 (ADCY2)
   04022 cGMP-PKG signaling pathway
    102171922 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102171922 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102171922 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102171922 (ADCY2)
   04062 Chemokine signaling pathway
    102171922 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    102171922 (ADCY2)
   04922 Glucagon signaling pathway
    102171922 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    102171922 (ADCY2)
   04912 GnRH signaling pathway
    102171922 (ADCY2)
   04913 Ovarian steroidogenesis
    102171922 (ADCY2)
   04915 Estrogen signaling pathway
    102171922 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    102171922 (ADCY2)
   04921 Oxytocin signaling pathway
    102171922 (ADCY2)
   04926 Relaxin signaling pathway
    102171922 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    102171922 (ADCY2)
   04918 Thyroid hormone synthesis
    102171922 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    102171922 (ADCY2)
   04916 Melanogenesis
    102171922 (ADCY2)
   04925 Aldosterone synthesis and secretion
    102171922 (ADCY2)
   04927 Cortisol synthesis and secretion
    102171922 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102171922 (ADCY2)
   04270 Vascular smooth muscle contraction
    102171922 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    102171922 (ADCY2)
   04971 Gastric acid secretion
    102171922 (ADCY2)
   04972 Pancreatic secretion
    102171922 (ADCY2)
   04976 Bile secretion
    102171922 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102171922 (ADCY2)
   04727 GABAergic synapse
    102171922 (ADCY2)
   04725 Cholinergic synapse
    102171922 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    102171922 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102171922 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    102171922 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    102171922 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102171922 (ADCY2)
   04714 Thermogenesis
    102171922 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102171922 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    102171922 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102171922 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102171922 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102171922 (ADCY2)
   05163 Human cytomegalovirus infection
    102171922 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102171922 (ADCY2)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102171922 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 102171922
NCBI-ProteinID: XP_017921111
UniProt: A0A452FU52
LinkDB
Position
20
AA seq 1091 aa
MWQEAMRRRRYLRDRAEAAAGGGDGLQRSRDWLYESYYRMSQQHPLIVFLLLIVMGACLA
LLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGAKQHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLQHLNGAYKVEEGDGDVRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWIKSEDIQRISLLFYNKILEKEYRATALPAF
KYYVTCACLIFFGIFIVQVLVLPKTSILGISFGAAFLSLALILFVCFAGQLLQCSKKASA
SLLWLLKSSGIIANRPWPRISLTVITTAIILTMAVFNMFFLSDSEETILPTANASNTSLS
GTSNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTIFLHT
HAPLLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHA
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSIILQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNLTS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcggcgccgctacctgcgggaccgcgccgaggcggcggcg
ggcggcggagacgggctgcagcggtcccgggactggctctacgaatcctactaccgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctcgcc
ctgctcgccgtcttcttcgcgctccgcctggaagttgaagaccacgtggcatttttaatc
acagttccgactgccctggcgattttctttgcgatcttcatcctggtgtgcatcgagtcg
gtgtttaagaagctgctgcgcctcttctctttggtgatatggatctgtctcgtggccatg
ggctacttgttcatgtgttttgggggcaccgtctctccctgggaccaggtgtcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagatgccatcatc
gccagcgtcctcacctcctcttctcacaccatcgtgctgagcgtctgcctgtctgcgacc
ccaggggccaagcagcacctggtctggcagatcctggccaacgtgatcatcttcatctgc
gggaacctggcgggggcgtaccataagcacctcatggagctcgctctgcagcagacgtat
caggacacgtgcaactgcatcaagtcccggatcaagctggaatttgaaaaacgtcagcag
gagcggctgctgctctccttgctgccggcacacatagccatggagatgaaagcggagatc
atccagaggctgcagggccccaaagccggccagatggagaacaccaacaacttccacaac
ctctacgtcaagcggcacaccaacgtcagtatcctctatgcggacattgttgggttcacc
cgtctggccagtgactgctcccctggagagctcgtccacatgctgaatgaactctttgga
aagttcgatcaaattgcaaaggagaatgaatgcatgagaataaaaattttaggggactgc
tactactgtgtgtccggactgcccatatctctccctaaccatgccaagaattgtgtgaaa
atgggactggatatgtgtgaagccataaagaaagtgcgggacgccaccggagtggacatc
aacatgcgcgtgggagtgcattctgggaacgtcctgtgcggcgtgatcgggctgcagaag
tggcagtacgacgtgtggtcacatgacgtcaccctggccaaccacatggaagctggaggg
gtccctggacgtgttcacatctcttctgttaccctgcaacacttgaatggagcttacaaa
gtggaagaaggcgatggtgacgtcagagacccgtatttaaagcaacacttggtgaaaact
tactttgtaatcaaccccaagggagagcggcggagccctcaacacctcttcaggccccga
cacacccttgacggagcgaagatgagggcttctgtccgcatgacccggtacctggagtcc
tggggggcggccaagccctttgcacacctgcatcatagagacagcatgactacggagaac
ggcaagatcagcaccacggatgtaccaatgggtcagcataattttcaaaaccgcacctta
agaacgaagtcacaaaagaaaagatttgaagaggaattaaatgaaaggatgattcaagca
attgatggaatcaatgcacagaagcaatggatcaagtccgaagacattcagagaatctca
ttgcttttctacaataaaatactagaaaaagaataccgagccaccgcactgccggccttc
aagtattacgtgacttgcgcttgcctcatcttcttcggcatctttatcgtgcaggttctg
gtcttacccaaaacgtccattctcgggatttcctttggagcggcgtttctctcacttgcc
cttatccttttcgtctgctttgctggacagcttttgcaatgcagcaagaaagcatctgct
tctctcctgtggcttttaaagtcatcgggcatcatcgccaaccggccttggcctcggatc
tccctgacggtcatcaccacagccatcatattgaccatggccgtgttcaatatgtttttc
ctgagtgactcagaggaaacaattcttccgactgccaacgcgtccaacacgagtctttct
ggcacaagtaaccaggcagcgattctgcgtgcgcaaaatttgtttttcctgccgtacttt
atatacagctgcatcctcgggctgatctcctgttctgtcttcctgcgtgtgaattatgag
ctgaagatgctgatcatgatggtagccttggtgggctacaacaccatcttcctccacact
cacgctcccctcctggacgactacagccaggtcctgttcgagagaccaggcatttggaaa
gacctaaagaccatgggctcagtatctctctttatatttttcatcacactgcttgttctg
ggcagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaa
gagcgggaggagatagaaaccatggagaacttgaaccgagtgctgctggagaatgtgctt
cctgcgcacgtggctgagcacttcctggcccggagcctgaaaaacgaggatttataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattcctgacttcaaagagttctat
acggagtccgacgtgaacaaggagggtttggaatgccttcggctcctgaacgaaatcatt
gccgactttgatgatctgctatccaagccgaagttcagtggcgttgaaaagatcaagacc
atcggcagcacgtacatggcagcgacgggtctgagcgcggtgcccagccaggagcacgcc
caggagcccgagaggcagtacatgcacattggcaccatggtggagtttgcgtttgccctg
gtggggaagctggacgccatcaacaagcactccttcaatgacttcaagttacgagtaggt
attaaccatggccctgtcatagccggtgtgattggagctcagaagccgcagtatgacatc
tggggcaacaccgtcaatgtggccagcaggatggacagcaccggagtcctggacaaaatc
caggtgacagaggagacgagcatcatcctacagaccctgggctacacgtgcacgtgtcgg
ggaatcatcaacgtgaaaggaaagggagacctgaagacctacttcgtcaacacggagatg
tcacggtccctttctcagagcaacctgacctcctga

KEGG   Capra hircus (goat): 102180724
Entry
102180724         CDS       T02910                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05142  Chagas disease
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102180724 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102180724 (ADCY1)
   04371 Apelin signaling pathway
    102180724 (ADCY1)
   04020 Calcium signaling pathway
    102180724 (ADCY1)
   04072 Phospholipase D signaling pathway
    102180724 (ADCY1)
   04024 cAMP signaling pathway
    102180724 (ADCY1)
   04022 cGMP-PKG signaling pathway
    102180724 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102180724 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102180724 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102180724 (ADCY1)
   04062 Chemokine signaling pathway
    102180724 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    102180724 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    102180724 (ADCY1)
   04912 GnRH signaling pathway
    102180724 (ADCY1)
   04913 Ovarian steroidogenesis
    102180724 (ADCY1)
   04915 Estrogen signaling pathway
    102180724 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    102180724 (ADCY1)
   04921 Oxytocin signaling pathway
    102180724 (ADCY1)
   04926 Relaxin signaling pathway
    102180724 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    102180724 (ADCY1)
   04918 Thyroid hormone synthesis
    102180724 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    102180724 (ADCY1)
   04916 Melanogenesis
    102180724 (ADCY1)
   04925 Aldosterone synthesis and secretion
    102180724 (ADCY1)
   04927 Cortisol synthesis and secretion
    102180724 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102180724 (ADCY1)
   04270 Vascular smooth muscle contraction
    102180724 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    102180724 (ADCY1)
   04971 Gastric acid secretion
    102180724 (ADCY1)
   04972 Pancreatic secretion
    102180724 (ADCY1)
   04976 Bile secretion
    102180724 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102180724 (ADCY1)
   04727 GABAergic synapse
    102180724 (ADCY1)
   04725 Cholinergic synapse
    102180724 (ADCY1)
   04720 Long-term potentiation
    102180724 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    102180724 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102180724 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    102180724 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    102180724 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102180724 (ADCY1)
   04714 Thermogenesis
    102180724 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180724 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    102180724 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102180724 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102180724 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102180724 (ADCY1)
   05163 Human cytomegalovirus infection
    102180724 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102180724 (ADCY1)
   05142 Chagas disease
    102180724 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102180724 (ADCY1)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102180724 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 102180724
NCBI-ProteinID: XP_017902539
UniProt: A0A452FYH7
LinkDB
Position
4
AA seq 1134 aa
MAGAPRGRGGGGGGGGAGESGGAERAAGPGGRRGLRACDEEFACPELEALFRGYTLRLEQ
AATLKALAMLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQ
LQQVGQLALLFSLTFALLCCPFALGGPAGAHAGVAAVPATADQGVWQLLLVTFVSYALLP
VRSLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLGVNMYGVFVRILAERA
QRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQR
HDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVS
GLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDV
WSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKTHNIETFFIVP
SHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRA
LRTASEKLRNRSSFSTNVVQATPGTRVNRYIGRLLEARQMELEMADLNFFTLKYKQAERE
RKYHQLQDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFCICFLVACVLYLHIT
RVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWSWSSSPNGSLVVLSSGGRDPV
LPAPPCESAPHALLCGLVGTLPLAIFLRVSSLPKMILLAVLTTSYILVLELSGYTKAMGA
GAVSGRSFEPIVAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDMEKVKLDNKRIL
FNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLL
NEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSHLSTLADFAIE
MFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGR
IQVTEEVHRLLRRGSYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQTRSLNSERKMCPY
GRAGLQTRLAAGHPPVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGASGKEA
NT seq 3405 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccgaggcggcggcggaggcggaggcggcgccggcgagtct
gggggcgccgagcgggcggcggggccgggcggccggcgcgggctgcgggcgtgcgatgag
gagttcgcgtgccccgagctggaggcgctgttccgcggctacacgctgcggctggagcag
gcggcgacgctgaaggcgctggccatgctcagcctgctggcgggcgcgctggccctggcc
gagctgctgggcgcgccggggcccgcgcccggcctggccaagggctcgcaccccgtgcac
tgcgtgctcttcctggcgctgctcgtggtcaccaacgtccgctcgctgcaggtgccccag
ctgcagcaggtcggccagctcgcgctgctcttcagcctcaccttcgctctgctgtgctgt
cccttcgcgctcggcggccccgccggtgcccacgccggggtggcagcggtgccggcgaca
gccgatcagggagtctggcagctccttttggtcaccttcgtgtcctatgccctgctgccc
gtgcgcagcctgctggccatcggcttcgggctcgtggtggccgcctcgcacttgctggtc
acagctacgttggtccccgccaagcgcccacgtctctggagaacgctgggtgccaacgct
ctgctcttccttggtgtgaacatgtatggtgtcttcgtgaggatcctggctgagcgcgcc
cagaggaaggccttcctgcaggcccggaactgcattgaggaccggctgaggctggaggac
gagaatgagaagcaggagcggctgctcatgagcctcctgcctcggaatgttgccatggag
atgaaggaggacttcctgaagccccctgagaggattttccacaagatttatatccagcgg
catgacaacgtgagcatcctctttgcagatatcgtgggcttcacaggcttggcgtcacag
tgcacggcccaggagctggtgaaactcctcaacgagctcttcgggaagtttgacgagctg
gccacggagaaccactgccgccgcatcaagatcctgggagactgctactactgcgtgtct
ggcctcactcagcccaagactgaccacgcccactgctgtgtggagatgggcctggacatg
atcgacaccatcacgtccgtggctgaggccactgaggtggacttgaacatgcgtgtgggg
ctgcacaccggcagggtcctctgtggggtcctgggcctgcgtaagtggcagtatgatgtg
tggtccaacgacgtgaccctggccaacgtcatggaggccgccggcctgcctgggaaggtt
cacatcacaaagaccaccctggcgtgcctgaacggtgactatgaggtggagccgggacac
ggacatgagaggaacagttttctgaaaacgcataacatcgagaccttttttattgtgccc
tcacatcggcgaaagatatttccagggctgattctctcagacataaaaccggccaagagg
atgaagttcaagactgtgtgctacctgctggtgcagctcatgcattgccggaagatgttc
aaggccgagatccctttctccaacgtcatgacctgtgaggacgacgacaagcggagggca
ttgagaacagcctcggaaaaactcagaaaccgctcgtctttctctacaaacgttgtccaa
gccacccccggcacacgtgtcaacaggtacatcggccgcctcctggaagcccgccagatg
gagctggagatggcagacctgaacttcttcaccctgaagtacaagcaagctgagcgagag
cgaaagtaccaccagcttcaggacgagtatttcaccagcgccgtggttctggctctcatt
ctggccgccttattcggccttgtctaccttctaataatcccacagagtgtggctgtcctg
ctcctgctggtgttctgcatctgcttcctggtggcctgtgtcctgtacctacacatcacc
cgggtccagtgttttccagggtgcctgaccatccagatccgcaccgtcttgtgcatcttc
atcgtggtcttaatctactctgtggcccaaggctgtgtggtgggctgcctgccttggtcc
tggagctccagtcccaatgggtccctggtggtcctgtcttccgggggccgggacccagtg
ctgcctgccccgccctgcgagtctgcgccccacgccctgctgtgcggcctcgtgggcacc
ctcccgctggccatattcctgcgggtctcctccttgccaaaaatgatcctgctcgccgtg
cttaccacctcctacatcctcgtcctggagctcagcgggtacacgaaggccatgggggcc
ggtgccgtctcagggcgcagcttcgagccaatcgtggccatcctgctattctcgtgcacg
ctggccctgcacgcccggcaggtggatgtcaagctgcggctggactacctctgggcggcc
caggcagaggaggagcgggatgacatggagaaagtgaagctggataacaagaggattctc
ttcaacctcctgccagcccacgttgcccagcacttcctaatgtcaaaccctcgcaacatg
gacctgtattaccagtcgtactcgcaggtgggggtcatgtttgcatccatccccaacttc
aatgacttctacattgagctggatggcaacaacatgggggtggagtgtctgcgccttctg
aacgagatcatcgccgactttgatgagctcatggacaaagacttttacaaagacctagag
aagatcaagaccatcgggagcacgtacatggctgctgtggggctggcgcccactgccggg
accaaggctaagaagtgcatctcctcccacctcagcacgctggcagattttgccattgag
atgtttgatgtcctggatgagatcaactaccagtcttataacgacttcgtgctccgtgtt
ggcatcaacgttggccctgtggtggctggagtgatcggggctcgcaggccacagtatgac
atttggggaaacacggtcaatgtggccagtcggatggatagtaccggcgtccagggcagg
atccaggtcacagaggaagttcaccggctgctgcggcggggttcctaccgcttcgtgtgc
cgaggcaaagtcagtgtcaagggcaagggcgagatgctgacgtacttcctggaaggcagg
accgatggaaatggctcccaaaccaggtccctgaactcagagcggaaaatgtgtccttac
ggaagagctggcctccagaccagactggccgcgggtcatcctccggtgccccccgcagct
ggcctcccggttggagctgggccaggggctctgcagggctcggggcttgccccaggcccc
ccaggccaacacctgccccctggagcctctgggaaggaggcttag

KEGG   Capra hircus (goat): 102184919
Entry
102184919         CDS       T02910                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102184919 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102184919 (ADCY8)
   04371 Apelin signaling pathway
    102184919 (ADCY8)
   04020 Calcium signaling pathway
    102184919 (ADCY8)
   04072 Phospholipase D signaling pathway
    102184919 (ADCY8)
   04024 cAMP signaling pathway
    102184919 (ADCY8)
   04022 cGMP-PKG signaling pathway
    102184919 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102184919 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102184919 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102184919 (ADCY8)
   04062 Chemokine signaling pathway
    102184919 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    102184919 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    102184919 (ADCY8)
   04912 GnRH signaling pathway
    102184919 (ADCY8)
   04913 Ovarian steroidogenesis
    102184919 (ADCY8)
   04915 Estrogen signaling pathway
    102184919 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    102184919 (ADCY8)
   04921 Oxytocin signaling pathway
    102184919 (ADCY8)
   04926 Relaxin signaling pathway
    102184919 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    102184919 (ADCY8)
   04918 Thyroid hormone synthesis
    102184919 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    102184919 (ADCY8)
   04916 Melanogenesis
    102184919 (ADCY8)
   04925 Aldosterone synthesis and secretion
    102184919 (ADCY8)
   04927 Cortisol synthesis and secretion
    102184919 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102184919 (ADCY8)
   04270 Vascular smooth muscle contraction
    102184919 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    102184919 (ADCY8)
   04971 Gastric acid secretion
    102184919 (ADCY8)
   04972 Pancreatic secretion
    102184919 (ADCY8)
   04976 Bile secretion
    102184919 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    102184919 (ADCY8)
   04727 GABAergic synapse
    102184919 (ADCY8)
   04725 Cholinergic synapse
    102184919 (ADCY8)
   04720 Long-term potentiation
    102184919 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    102184919 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    102184919 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    102184919 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    102184919 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    102184919 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102184919 (ADCY8)
   04714 Thermogenesis
    102184919 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102184919 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    102184919 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102184919 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102184919 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102184919 (ADCY8)
   05163 Human cytomegalovirus infection
    102184919 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102184919 (ADCY8)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102184919 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 102184919
NCBI-ProteinID: XP_017914061
UniProt: A0A452G620
LinkDB
Position
14
AA seq 1255 aa
MELSDVRCLSGSEELYTIRPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GGGNGSSSKASDPGGGGPNHHHHASQLSGDSALPLYALGLGERAHGTGGPKVFPERSGSG
SGSGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLG
QRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDT
TSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAG
LGTSLMQVVLQAVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRC
VEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSIL
FADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQ
DHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDI
ANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLS
LPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQ
ALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNL
VCAFIVLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCC
WINETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYF
VFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLG
TKEASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILP
SHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIA
DFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQE
INKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEET
YLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVV
LGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGAPAEGADKSELP
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccgcccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcatccacgggcaccgcggcggcggcggcggc
ggcggcgggaacgggagctccagcaaagcctcggaccccggaggcggcggccccaaccac
caccaccacgcgtcgcagctgtccggcgactcggcgctgcccctctacgcgctgggcctt
ggggagcgagcgcacggcaccggcggccccaaagtcttcccggaacgcagcgggagcggc
agcggcagcggcagcggcggcgggggcgacctgggcttcctgcacctcgactgcgccccg
agcaactcggatttcttcctcaatgggggctacagctaccgaggggtcattttccccacc
ctgcgcaactccttcaagtcccgggatctggagcgcctctaccagcgctatttcctgggc
cagaggcgcaaatcggaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctc
ctggttctccacttgagcctggcctcggcccccatggacccgctcaagggcatcctgctg
ggcttcttcaccggcatagaggtggtgatctgcgccctggtggtggtcaggaaggacacc
acctcgcacacatacctgcagtacagcggtgtggtcacttgggtagccatgaccacccag
atcttagcagcagggctcggctatgggctcctgggagacggcatcggctacgtgctcttc
accctttttgccacctacagcatgctgccgctgccgctcacctgggccatcctggccggc
ctaggcacctctttgatgcaggtggtcctccaagcggtcatccccaggctggcggtcatt
tccatcaatcaggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatc
ttcatcagttacctgtcagaccgggcccagcgccaagccttcctggagacacggaggtgt
gtggaggccaggctgcgcctggagacggaaaaccaaagacaggagcgacttgtgctgtcc
gtgcttcctcgttttgttgtcctggagatgatcaatgatatgaccaacgtggaagacgag
cacctgcagcatcagttccaccggatctacatccatcgctatgagaatgtcagtattctt
tttgcagatgttaaaggatttaccaacctctccacgaccttgtctgctcaggagctggtc
aggatgctcaacgagctctttgccagatttgatcgactggcccatgagcatcactgcctt
cgtattaaaatcctgggggactgctactactgcgtttcaggacttcctgagccccgccag
gaccacgcccactgctgtgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtg
cgatcaaggacaaagcacgatgttgacatgcggattggaatccactcgggctcggtgctg
tgtggcgtgttgggtcttcggaagtggcagtttgatgtctggtcttgggatgtggacatt
gcgaacaaacttgaatctggaggaatccccgggcggattcacatttccaaagccacgctg
gactgcctcaacggtgactataatgtggaagagggccacggaaaagagaggaatgaattc
ttgaggaagcataatatagagacctatttaattaagcagcccgaggagagtctgctgtct
ttgcccgaagacatcgtcaaggagtctgtgagctcctcagacaggagaaacagcggggca
acgttcacagagggatcttggagccctgaactgcccttcgataacatagtggggaaacag
aacactctggctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaa
gctttgcatgtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgac
ttgcggagtggtgataaattgagaagagagcatatcaagccattctcactgatgtttaaa
gactccagcctggagcacaagtattctcaaatgagggatgaagtattcaaatcaaacttg
gtctgtgcgtttatcgttcttctatttatcacggcaatacaaagcttgcttccttcttca
agagtgatgcccatggccatccagttttccatcctgatcatgctgcactcggctctggtc
ctcatcactacggcggaggattacaagtgcttgcccctggtcctccgaaaaacctgctgt
tggattaacgagacctatttggccaggaacgtcatcatctttgcatccatcttgattaat
ttcctgggagccatcctaaatatcctgtggtgtgattttgacaagtcgatacccttgaag
aacctgactttcaattcctcagctgtgtttacagatatctgctcctacccagagtacttt
gtcttcacgggggtgttggccatggtgacctgtgcagttttcctccgactcaactctgtc
cttaagctggctgtgctcctgatcatgattgccatctatgccctgctgaccgagaccatc
tatgcaggcctctttctgcgctacgacaacctgaaccacagcggagaggatttcctgggg
accaaggaagcgtcgctgctgctgatggccatgttccttctagctgtgttctaccacgga
cagcagctggagtacacggcccgcctggacttcctgtggcgagtccaggccaaagaggag
atcaacgagatgaaggagctgagggagcacaatgagaacatgctgaggaacatcctgccc
agccacgtggcccgccacttcctggagaaggaccgggacaatgaggagctgtattctcaa
tcctatgatgcagttggggtgatgtttgcctccatcccagggtttgcagacttttactct
cagaccgaaatgaacaaccaaggagtggaatgcctccgcctgctgaatgagatcattgct
gacttcgatgagctgctcggtgaagaccggtttcaagacattgaaaagattaagaccatt
ggtagtacctacatggctgtgtcaggcctgtcacctgaaaagcagcaatgcgaggataag
tgggggcatttgtgcgccctggccgatttctccctcgccctgactgaaagcatccaggag
atcaacaagcattccttcaacaattttgagctccggattggcatcagccacggctcggtg
gtagccggcgtcatcggcgctaagaaaccacagtacgacatttggggcaaaaccgtgaac
ctggcgagtcggatggacagcacgggggtcagcggcaggatccaggtcccggaggagacc
tacctcatcctgaaggaccagggctttgcctttgactaccgaggggagatctatgtgaag
ggcatcagcgaacaggaagggaaaatcaaaacgtactttctcctgggaagagtccagccc
aaccccttcatcctaccccccaggagactgcccgggcagtactccctggccgcggtggtc
ctgggcctcgtccagtccctcaacaggcagaggcagaagcagctgctgaacgagaacaac
aacacgggcattatcaagggccactacaaccggcggactttgctgacacccagcgggcca
gagccgggagccccagccgaaggcgccgacaagtccgagttgccatga

KEGG   Capra hircus (goat): 102185469
Entry
102185469         CDS       T02910                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102185469 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102185469 (ADCY4)
   04371 Apelin signaling pathway
    102185469 (ADCY4)
   04020 Calcium signaling pathway
    102185469 (ADCY4)
   04072 Phospholipase D signaling pathway
    102185469 (ADCY4)
   04024 cAMP signaling pathway
    102185469 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102185469 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102185469 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102185469 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102185469 (ADCY4)
   04062 Chemokine signaling pathway
    102185469 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102185469 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102185469 (ADCY4)
   04912 GnRH signaling pathway
    102185469 (ADCY4)
   04913 Ovarian steroidogenesis
    102185469 (ADCY4)
   04915 Estrogen signaling pathway
    102185469 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102185469 (ADCY4)
   04921 Oxytocin signaling pathway
    102185469 (ADCY4)
   04926 Relaxin signaling pathway
    102185469 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102185469 (ADCY4)
   04918 Thyroid hormone synthesis
    102185469 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102185469 (ADCY4)
   04916 Melanogenesis
    102185469 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102185469 (ADCY4)
   04927 Cortisol synthesis and secretion
    102185469 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102185469 (ADCY4)
   04270 Vascular smooth muscle contraction
    102185469 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102185469 (ADCY4)
   04971 Gastric acid secretion
    102185469 (ADCY4)
   04972 Pancreatic secretion
    102185469 (ADCY4)
   04976 Bile secretion
    102185469 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102185469 (ADCY4)
   04727 GABAergic synapse
    102185469 (ADCY4)
   04725 Cholinergic synapse
    102185469 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102185469 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102185469 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102185469 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102185469 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102185469 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102185469 (ADCY4)
   04714 Thermogenesis
    102185469 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185469 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102185469 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102185469 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102185469 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185469 (ADCY4)
   05163 Human cytomegalovirus infection
    102185469 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102185469 (ADCY4)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102185469 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102185469
NCBI-ProteinID: XP_017910123
UniProt: A0A452FG15
LinkDB
Position
10
AA seq 1077 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALFPVAWASGRELAADPA
FLTTVLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLDMRDAITAGVTTSFLHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
EEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPWAAEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKSLSSFSPQWSLDRSRTMRALDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALTITYSITFLLFFLLLFVCFSEHLMKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLVFVMAITSLVFLPAASACPFQAPNVSSMASNLSWEIPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSIFLHSHAWLSDCLIARLYLGTLDS
RPGVLKEPKLMGAASFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNAASGQDAQQDAEQSCGHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcagccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgttccctgtggcctgggcaagtggcagggagctggccgcagacccagcc
ttcctgaccactgtgctctgcgctctgggcggcttctcactgctgctggtcctggcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtcaggcctcgtgtgggcagcactg
ctcgcactgggccacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcactgtgtatgccatgttgcccttggacatgagggac
gccatcaccgcgggggtcaccacctcattcttgcacctgctggtccttgggctgtatctt
gggcctcagcccgactctcggccggcgctgctgccacagctggctgcaaacgcggtgctg
ttcctgtgcgggaacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagctccctgcactcgcggcggagactggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gaggagatcatggcccgactgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcgactggccagtgagtgctcccctaaggagttggtgcttatgctcaacgag
ctctttggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctgccgctctccctgccagaccacgccatcaat
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccacgggc
gtggatatcaacatgcgtgtgggcgtgcactcaggcagcgtgctctgcggggttatcggg
ctacagaaatggcagtatgatgtctggtcccatgacgtcactctagccaaccacatggag
gcgagtggagtgccagggcgagtacatatcacaggggccacgctggccctgctggccggg
gcttatgctgtggaggatgcagccatggagcaccgggacccataccttcgggagctaggg
gagccgacctacctggtcatcgacccctgggctgcagaggaggacgagaagggcactgca
ggagggttgctgtcctctctggagggccccaagatgcgtccgtccctgctgatgacccgc
tacctggagtcctggggtgcagccaagcctttcgcccacctgagccatgtagagagccct
gtgtccacgtctacccctctcccggagaagtccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccatgcgggcacttgacgaggaactagacactggggatgccaag
ttcttccaggtcatcgaacagctcaattctcagaaacagtggaaacagtcaaaggacttc
aatccactgacactgtacttcagagagaaggagatggagaaagagtatcggctctctgca
ctccccgccttcaaatactatgcagcctgcaccttcctggtttttctctccaacttcatt
atccagatgctggtgaccaacaggcctccagctctgaccatcacctatagcatcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgatgaagtgtgtcttg
aaaggccccaagatgctgcactggctacccaccctgtctgtcctggtggccacacggcca
ggactgcgagtggctctgggcaccgctaccatcctgctcgtcttcgtcatggccattacc
agtctggtcttcttaccagcagcatcagcctgccctttccaggctcccaatgtatcctcc
atggcttccaacctctcctgggagatccctgggtccctgcctctcatcagcgtgccctac
tccatgcattgctgcgtgttggggttcctctcctgctccctcttcctgcacatgagcttt
gagctgaagctgctgctgcttctgctgtggctgacggcctcctgctccatcttcctgcac
tcccatgcctggttgtccgactgcctcatcgcccgcctctacctgggcaccttggactcc
aggccaggggtgctgaaggagcccaaactgatgggagcagcctccttcttcatcttcttc
ttcaccctcctagtcctggctcggcagaacgaatattactgccgcctggactttctgtgg
aagaagaagctgaggcaagagcaggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcccacgtggccccccagtttattggtcagaatcggcgc
aatgaggacctctaccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcggtccca
gactttaaggagttctactctgagtccagcatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgaaataatcgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaaaaccatctgcagcacctacatggcagctaccggcttgaacgccgcc
tcgggacaggatgcacagcaggatgctgagcagagctgcggccaccttggcaccatggta
gagtttgctgtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtagggttaaaccacggacctgtagtggctggagtgattggggcccag
aaaccacaatatgatatctggggcaacacggtgaacgtggccagccgcatggagagcaca
ggcgtcctgggaaaaattcaggtaacagaagagacagcccgggccctgcagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcttgaacacagacttaacacgaactggacctccctcagccaccctaggctga

KEGG   Capra hircus (goat): 102185858
Entry
102185858         CDS       T02910                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102185858 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102185858 (ADCY7)
   04371 Apelin signaling pathway
    102185858 (ADCY7)
   04020 Calcium signaling pathway
    102185858 (ADCY7)
   04072 Phospholipase D signaling pathway
    102185858 (ADCY7)
   04024 cAMP signaling pathway
    102185858 (ADCY7)
   04022 cGMP-PKG signaling pathway
    102185858 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102185858 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102185858 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102185858 (ADCY7)
   04062 Chemokine signaling pathway
    102185858 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    102185858 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    102185858 (ADCY7)
   04912 GnRH signaling pathway
    102185858 (ADCY7)
   04913 Ovarian steroidogenesis
    102185858 (ADCY7)
   04915 Estrogen signaling pathway
    102185858 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    102185858 (ADCY7)
   04921 Oxytocin signaling pathway
    102185858 (ADCY7)
   04926 Relaxin signaling pathway
    102185858 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    102185858 (ADCY7)
   04918 Thyroid hormone synthesis
    102185858 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    102185858 (ADCY7)
   04916 Melanogenesis
    102185858 (ADCY7)
   04925 Aldosterone synthesis and secretion
    102185858 (ADCY7)
   04927 Cortisol synthesis and secretion
    102185858 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102185858 (ADCY7)
   04270 Vascular smooth muscle contraction
    102185858 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    102185858 (ADCY7)
   04971 Gastric acid secretion
    102185858 (ADCY7)
   04972 Pancreatic secretion
    102185858 (ADCY7)
   04976 Bile secretion
    102185858 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    102185858 (ADCY7)
   04727 GABAergic synapse
    102185858 (ADCY7)
   04725 Cholinergic synapse
    102185858 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    102185858 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102185858 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    102185858 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    102185858 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102185858 (ADCY7)
   04714 Thermogenesis
    102185858 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185858 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    102185858 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102185858 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102185858 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185858 (ADCY7)
   05163 Human cytomegalovirus infection
    102185858 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102185858 (ADCY7)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102185858 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF2417 LHC
Other DBs
NCBI-GeneID: 102185858
NCBI-ProteinID: XP_017917429
LinkDB
Position
18
AA seq 1080 aa
MPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLMLLLVAIAACITLIVITFSYGDPS
RHRAVLGTAFFTLAVFVVLYALVYAECLHRRGLRVSALLIWACLMTLGYVLVFDFDLQRK
NTCAREQVPFFLFVVFVVYTLLPFSMWEAVTAGLVSSASHLLVLAILAEAFTELNVHLGL
QLLATAVVFLCGNLMGAFHKHHMQDASHDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLP
AHISMGMKLAIIERLKERGDRRYLPDNNFHNLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCEAI
KQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLKHLDKAYEVEDGHGQQRDPYLKEMNIHTYLVIDPRSQQPPQPSQHNSKNKGDATLKM
RASVRMTRYLESWGAARPFAHLNQRESVSSSETLVSHGRRPKAVPLRRHRTPDRSASPKG
RSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFSTFGSIFLEKGFEREYRLAPIPRVRYYFA
CASFVFVCVLLIHVLLLSRAKTLGVSFGLVACVLGLVLALCFAYEFLRCCPARGKLRAIT
ESVETQPLLRVSLAILTIGSLLVIAVINLPLMPFRDWGLPVGNETGLRAVSGCEMSPCYL
LPDYTCSCILAFIACSVFLRMSLELKVVLLTMALVAYLALFNVSPSWQWDCCGYSMGNLT
GTNGTLSSSSCSWHLKTMINFYLVLFYTTLIMLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSIPSGPENQDLERQHAH
IGIMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccccgaccaggatgcg
ctctacgagaagtaccgcctcaccagccagcatgggccgctcctgctgatgctcctgttg
gtggccatcgctgcctgcatcacgctgatcgtcatcaccttcagctatggggacccctcc
agacaccgggccgtcctggggacggcgttcttcacgcttgctgtgtttgtggtcctctac
gcgctggtgtatgctgagtgcctccaccggcgggggctcagggtttcagcgctgctcatc
tgggcctgcctcatgacgctgggctacgtgctggtgtttgatttcgacttgcagaggaag
aacacctgtgcccgggagcaggtccccttcttcctgttcgtggtcttcgtggtgtacacg
ctgctgcccttcagcatgtgggaggccgtcacggccggactcgtctccagcgcctcccac
ctcctggtgcttgccattctggcggaagccttcaccgagctcaatgtccacctggggctg
cagctgctggccactgcggtggtcttcctgtgcgggaacctcatgggcgccttccacaag
caccacatgcaggacgcctcccacgacctctttacctacaccgtgaagtgcatccagatt
cggcggaagctgcgcattgagaagcgccagcaggagaacctgctgctgtccgtgctgccc
gcccacatttccatgggcatgaagctggccatcatcgagcggctcaaggagcgtggggac
cgccgttacctgcccgacaacaacttccacaacctctatgtcaagaggcaccagaatgtc
agcatcctctacgctgacatcgtgggcttcacgcgactggccagtgactgctcccccaaa
gagctggtggtggtgctgaacgagctcttcggcaagtttgaccagatcgccaaggccaac
gagtgcatgcggattaagatcctgggtgactgctactactgtgtgtccggcttgcctgtg
tccctgcccaaccatgcccgcaactgtgtgaagatggggctggacatgtgtgaggccatc
aagcaggtgcgtgaggccacaggcgtggacatcaacatgcgcgtgggcatccactcgggg
aacgtgctgtgtggtgtcatcgggctgcgcaagtggcagtatgacgtgtggtcccacgac
gtgtccctggccaacaggatggaggcggccggagtccctggccgggtgcatatcacagag
gcgacgctgaagcacctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgg
gacccttacctcaaagagatgaacatccacacctacctggtcatcgacccccggagccag
cagccgcctcagcccagccagcacaactccaagaacaagggggatgcgaccctgaagatg
cgggcgtccgtgcgcatgacgcgctacttggagtcctggggggcggctcgccccttcgcg
cacctcaaccaacgcgagagcgtgagcagcagcgagacccttgtgtcccacgggcggagg
cccaaggccgttcccctgcggcgccaccggacccctgacagaagcgcgtcccccaagggg
cggtcagaggacgactcatacgacgatgagatgttgtcagccatcgaggggctcagctct
accagaccctgctgctccaagtctgatgacttctccacctttgggtccatcttcctggag
aagggcttcgagcgagagtaccgcctggcgcccatcccccgggtccgctactacttcgct
tgtgccagcttcgtcttcgtctgcgtcctgctcatccacgtcttgctgttgtccagggca
aagactctgggtgtgtcctttgggctggtggcctgcgtgctcgggctggtactagccttg
tgcttcgcctatgagttcttgaggtgctgcccggcccgggggaagctccgagccatcacc
gagagcgtggagacgcagcccctgctgcgggtgtccctggccatcctgactatcggcagc
ctgctcgtcatcgctgtcatcaacttgccgctgatgcccttccgggactgggggctgcct
gttgggaatgagacaggcctgagggctgtgagcggctgtgagatgagcccgtgctacctc
ctcccggactacacctgcagctgcatcctggccttcatcgcttgctctgtcttcctgcgg
atgagcctggagctgaaggtcgtgctgttgaccatggccttggtggcctacctggccctc
ttcaatgtctccccgagctggcagtgggactgctgtggctacagcatgggcaacctcacc
gggaccaatggcaccctcagctcctcatcctgttcatggcatctgaagacgatgatcaat
ttctacctggtcttgttctataccaccctcatcatgctctccagacagattgactattac
tgccgcctggactgtctgtggaagaagaagttcaagaaggaacatgaggagtttgaaacc
atggagaacgtgaaccgccttcttctagagaatgtcctgcccgcacacgtggccgcccac
ttcatcggtgacaagttaaacgaggactggtaccatcagtcctacgactgcgtgtgtgtc
atgtttgcgtcggtgccggactttaaagtcttctacacagagtgcgacgtcaacaaggaa
gggctggagtgcctgcgcctgctcaacgagatcatcgccgactttgatgagctgctgtta
aagccgaagttcagtggtgtggagaagatcaagaccatcggcagcacgtacatggccgct
gcggggctcagcatcccctcagggcctgagaatcaggacctggagcggcagcacgcccac
atcggcatcatggtggagttcagcaccgccctgatgagcaagctggacggcatcaatcgg
cactccttcaactcctttcgcctccgagttggcataaaccatgggcctgtgattgctgga
gtgattggggcacgaaaacctcagtacgacatctggggaaacacggtcaatgttgccagt
cgaatggagagcactggagaacttggaaaaatccaggttactgaagagacatgtaccatc
ctccagggactagggtattcctgtgagtgccgcgggctgattaatgtcaaaggcaaaggg
gaactgaggacttactttgtctgtacagataccgctaagttccaaggcctggggctgaac
tga

KEGG   Capra hircus (goat): 102188104
Entry
102188104         CDS       T02910                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04727  GABAergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05032  Morphine addiction
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102188104 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102188104 (ADCY9)
   04371 Apelin signaling pathway
    102188104 (ADCY9)
   04020 Calcium signaling pathway
    102188104 (ADCY9)
   04072 Phospholipase D signaling pathway
    102188104 (ADCY9)
   04024 cAMP signaling pathway
    102188104 (ADCY9)
   04022 cGMP-PKG signaling pathway
    102188104 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102188104 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102188104 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188104 (ADCY9)
   04062 Chemokine signaling pathway
    102188104 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    102188104 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    102188104 (ADCY9)
   04912 GnRH signaling pathway
    102188104 (ADCY9)
   04913 Ovarian steroidogenesis
    102188104 (ADCY9)
   04915 Estrogen signaling pathway
    102188104 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    102188104 (ADCY9)
   04921 Oxytocin signaling pathway
    102188104 (ADCY9)
   04926 Relaxin signaling pathway
    102188104 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    102188104 (ADCY9)
   04918 Thyroid hormone synthesis
    102188104 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    102188104 (ADCY9)
   04916 Melanogenesis
    102188104 (ADCY9)
   04925 Aldosterone synthesis and secretion
    102188104 (ADCY9)
   04927 Cortisol synthesis and secretion
    102188104 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102188104 (ADCY9)
   04270 Vascular smooth muscle contraction
    102188104 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    102188104 (ADCY9)
   04971 Gastric acid secretion
    102188104 (ADCY9)
   04972 Pancreatic secretion
    102188104 (ADCY9)
   04976 Bile secretion
    102188104 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102188104 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102188104 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    102188104 (ADCY9)
   04727 GABAergic synapse
    102188104 (ADCY9)
   04725 Cholinergic synapse
    102188104 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    102188104 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102188104 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    102188104 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    102188104 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102188104 (ADCY9)
   04714 Thermogenesis
    102188104 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188104 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    102188104 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102188104 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102188104 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102188104 (ADCY9)
   05163 Human cytomegalovirus infection
    102188104 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102188104 (ADCY9)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102188104 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 AC_N
Other DBs
NCBI-GeneID: 102188104
NCBI-ProteinID: XP_017896218
UniProt: A0A452E8C5
LinkDB
Position
25
AA seq 1354 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVRINPKQPSSNSHPKHCKYSISSSCSSSGDS
GGVPRRMGAGGRLRRRKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMKSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDNFNHTRAARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLILGVAYSVLFETFGYHFQGEACFPSPGPEALHWELLSRALLHLCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERVGQSVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVLDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFTPKPEAGAEGGTVQNGCQEEPKN
SAKASGGPSSKTQNGLLSPPPEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDPELERAYRTSYQEEVIKNSPVKTF
ASATFSSLLDVLLSATVFLILSITCFLKYGAASTPPPPAAVAVFGAALLLEILSLVVSVR
MVFFLEDVMTCTKRLLEWIAGWLPRHFIGAILVSLPALSVYSHVTSEFETNIHSTVFTGS
AVLTAVVQYCNFCQLSSWMRSSLATVVGAGPLLLLLYVSLCPDSSTVISHLDAVQNFSST
RKLCNASLPHDNRSPATLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRT
KIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGK
ECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTTQCRDGSHPQEHLQILF
EFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDT
TGVECRIQVSEESYRVLSKMGYEFDYRGTVNVKGKGQMKTYLYPKCTDSGLVPQHQLSIS
PDIRVQVDGSIGRSPTDEIASLVPSVQNPDQVSLGSENNAQTRDAHSSAKRPWKEPVRAE
ERCRFGKAIEKSDCEEAGMEEANELTKLNVSERA
NT seq 4065 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagctgtgac
tccagcggagacagcaacagcgtgcgggtcaggatcaaccccaagcagccgtcctccaac
agccacccaaagcactgcaagtacagcatctcctccagctgcagcagctccggggactcc
ggaggggtcccccggagaatgggcgcgggaggccgcctgcgcaggaggaagaagctgccc
cagctgttcgaacgggcctccagccggtggtgggaccccaagttcgactccgtgaatttg
gaggaggcttgcatggagcgttgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgcctgctctggagcatctattttggggtccacatgaaatcg
aaactgattgtcatggtagcccctgctttatgcttcctcgtggtgtgtgtgggctttttt
ctgtttaccttcaccaagttgtacgcccgccattacgtgtggacttctctggttctcacc
ctcctggtattcgccctgaccctggctgcccagtttcaggttttgacgccactctcagga
cgagttgacaacttcaatcatactcgggctgccaggcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgattttgggagtggcctattctgttctttttgagacctttggc
taccacttccaaggtgaagcctgctttccctcacctggaccggaggccctgcactgggag
ctgctgagccgggccctgctccacctctgcatccacgccatcgggatccacctgttcatc
atgtcccaggtgagatccaggagcacctttctcaaggtgggccagtctattatgcacgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaagaagtcttccatccagaaagcccctatc
gcctttcgcccgtttaagatgcagcagatcgaagaagtcagtattttatttgcagatata
gtgggcttcaccaagatgagtgccaataagtctgcccacgccttggtgggtctcctcaac
gatctgttcggccgctttgaccggttgtgtgaggagaccaaatgtgagaaaatcagcacc
ctgggagactgctactattgtgtggctgggtgtcctgagccaagggccgaccatgcctac
tgctgcatcgagatggggttgggcatgataagagccattgagcagttctgccaagagaag
aaagagatggtgaacatgcgcgttggggttcacacggggaccgtcctctgtggcatcttg
ggcatgaggaggtttaaatttgatgtgtggtccaatgatgtgaacttggccaatctcatg
gaacagctgggagtggctggcaaggtccacatttccgaggccaccgcaaaatacctagat
gaccggtacgaaatggaggatgggaaagttaccgaacgcgttggccagagtgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcac
tgcagctgttcagaggccttactttctggctttgaggtccttgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcgtcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccgtcatgtggaatcacgttcactcccaag
ccagaagctggtgcagaaggcgggacggtccagaacggctgtcaggaggagcccaagaac
agcgccaaggcctccggaggacccagctccaaaacgcaaaatggacttctgagccctccc
ccagaggagaagctcaccaacagtcagacctctctgtgcgagatcttacaggagaagggc
aggtgggcaggcgtgagcctggatcagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacagacgcccactttgtcgatgttatcaaggaagacagcctgatgaaagac
tacttttttaagccgcccattaaccagttcagcttgaacttcctggatccggagctcgag
cgggcctacaggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgcttctgtcggcaacagtgtttctgatt
ctctccatcacctgcttcctgaagtacggggccgcctccacgccgcccccgccggccgct
gtggcagtcttcggagcggccctgctgctggagatcctgtccctcgtggtctctgtcagg
atggtgttcttcctggaggatgtgatgacgtgcaccaaacgcctgctggagtggatagcc
ggctggctcccacgccatttcatcggggccatcctggtgtccctccctgccctgtcggtg
tattcacacgtcacctctgaatttgagacaaacatacactccaccgtgttcacgggctcg
gccgtgctgaccgccgtggtgcaatactgcaacttctgccagctcagctcctggatgcgg
tcctccctggccactgtcgtcggggccgggcccctgctgctgctgctctacgtctccctg
tgcccagacagttccactgtaatttcacaccttgatgcagtgcagaatttcagctccacg
aggaagctgtgcaacgcctcgctgcctcacgacaacaggagcccagccaccctgatcggc
caggaggtgattctcgtcttcttcctcctgctcctgttggtctggttcctgaaccgggag
ttcgaagtcagctaccgcctgcactaccacggggacgtggaagcggacctgcaccgcacc
aagatccagagcatgagggaccaggccgactggctgctgaggaacatcatcccctaccac
gtggccgagcagctgaaggtgtcccagacctactccaagaaccacgacagcggcggcgtc
atcttcgccagcattgtcaacttcagtgagttctacgaggagaactacgagggcggcaag
gagtgctacagggtcctcaacgagctgatcggggacttcgacgagctcctgagcaagccg
gactacagcagcatcgagaagatcaagaccatcggggcgacatacatggccgcgtctggg
ctgaacaccacgcagtgccgcgacggcagccacccgcaggagcacctgcagatcctcttc
gagttcgccaaggagatgatgcgtgtggtggatgacttcaacaacaacatgctgtggttc
aacttcaagctcagggtgggcttcaaccatgggcccctgacagcgggcgtcatcggcacc
accaagctgctgtacgacatctggggagacacggtcaacatcgccagcaggatggacacc
acgggggtggagtgccgcatccaggtcagcgaggagagctaccgcgtcctgagcaagatg
ggctacgagttcgactaccgagggacggtgaacgtcaagggcaaaggccagatgaagacc
tacctgtaccccaagtgcacagacagtgggttggtgccgcagcaccagctgtccatctca
cccgacatccgggtccaggtggatggcagcatcggacgctcccccacagatgagatagcc
agcctggtgccttccgttcagaacccagaccaggtgtccctgggttccgagaacaacgcc
cagaccagggacgctcactcgtctgctaagagaccctggaaggagcccgtcagagccgaa
gaaaggtgtcggttcggcaaagccatagagaaaagcgactgtgaagaagcggggatggag
gaagccaacgaactcacaaagctcaacgtctcagagagggcgtga

KEGG   Capra hircus (goat): 102189798
Entry
102189798         CDS       T02910                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00230  Purine metabolism
chx01100  Metabolic pathways
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05012  Parkinson disease
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05034  Alcoholism
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102189798 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102189798 (ADCY5)
   04371 Apelin signaling pathway
    102189798 (ADCY5)
   04072 Phospholipase D signaling pathway
    102189798 (ADCY5)
   04024 cAMP signaling pathway
    102189798 (ADCY5)
   04022 cGMP-PKG signaling pathway
    102189798 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102189798 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102189798 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102189798 (ADCY5)
   04062 Chemokine signaling pathway
    102189798 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    102189798 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    102189798 (ADCY5)
   04912 GnRH signaling pathway
    102189798 (ADCY5)
   04913 Ovarian steroidogenesis
    102189798 (ADCY5)
   04915 Estrogen signaling pathway
    102189798 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    102189798 (ADCY5)
   04921 Oxytocin signaling pathway
    102189798 (ADCY5)
   04926 Relaxin signaling pathway
    102189798 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    102189798 (ADCY5)
   04918 Thyroid hormone synthesis
    102189798 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    102189798 (ADCY5)
   04916 Melanogenesis
    102189798 (ADCY5)
   04924 Renin secretion
    102189798 (ADCY5)
   04925 Aldosterone synthesis and secretion
    102189798 (ADCY5)
   04927 Cortisol synthesis and secretion
    102189798 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102189798 (ADCY5)
   04270 Vascular smooth muscle contraction
    102189798 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    102189798 (ADCY5)
   04971 Gastric acid secretion
    102189798 (ADCY5)
   04972 Pancreatic secretion
    102189798 (ADCY5)
   04976 Bile secretion
    102189798 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    102189798 (ADCY5)
   04727 GABAergic synapse
    102189798 (ADCY5)
   04725 Cholinergic synapse
    102189798 (ADCY5)
   04728 Dopaminergic synapse
    102189798 (ADCY5)
   04726 Serotonergic synapse
    102189798 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    102189798 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102189798 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    102189798 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    102189798 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102189798 (ADCY5)
   04714 Thermogenesis
    102189798 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102189798 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102189798 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    102189798 (ADCY5)
   05031 Amphetamine addiction
    102189798 (ADCY5)
   05032 Morphine addiction
    102189798 (ADCY5)
   05034 Alcoholism
    102189798 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102189798 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102189798 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102189798 (ADCY5)
   05163 Human cytomegalovirus infection
    102189798 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102189798 (ADCY5)
Enzymes [BR:chx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102189798 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF2339 TBK1_ULD PEN-2
Other DBs
NCBI-GeneID: 102189798
NCBI-ProteinID: XP_017901240
UniProt: A0A452FR89
LinkDB
Position
1
AA seq 1259 aa
MSSSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPQAPGGSARGSTKRPGGA
VTPQQQQRLASRWRSDDEDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAAGGGSTRAPPAGSGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRAAEDLEAGAVEE
DEGSGDGGSSAGSGSGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSSL
TMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMGLAC
YALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHL
AIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQ
RENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLA
SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGM
DMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAG
RIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQ
RTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESSNPEDEVDEFLGR
AIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITV
VPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKMNSTLVGVFTI
TLVFLSAFVNMFTCNSKDLFGCLGDEHNISASQVNACHVVESAVNYSLGDEQGFCGSSWP
NCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLLV
TANAIDFNNNGTSQCPEHPTKVALKVVTPVIISVFVLALYLHAQQVESTARLDFLWKLQA
TEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSE
FYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDK
VGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNT
VNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPPS
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacaccgctccgcgtggggagaggccgactcccgcgccaat
ggctacccccaagcccccgggggttcggcccgcggctccaccaagagacctgggggggcg
gtgaccccgcagcagcaacagcgcctggccagccgctggcgcagcgacgacgaagacgat
cctccgctgagtggcgatgaccccctggccgggggcttcggcttcagcttccgttccaag
tcggcctggcaggagcgcggcggcgacgactgcggtcgcggcagccggcggcagcggcgg
ggcgcggccggcgggggcagcacccgggcgccccctgcgggcagcggcggcggttcggcg
gctgcggccgccgcagcgggaggaacggaggtgcgcccccgttcggtggagctaggcctg
gaggagcggcgtggcaagggccgcgcggccgaagatctggaggccggcgccgtcgaggaa
gacgaagggtccggggatgggggcagctcggcaggctcgggctcggggcctggcgcggtg
ctgtcgctgggcgcctgctgcctggcactgctgcagatattccgctcgaagaagttccca
tcggacaagctggagcggctgtaccagcgctacttcttccgtctgaaccagagcagcctc
acgatgctcatggctgtgctggtgctcgtgtgcctagtcatgttggccttccacgccgca
cggcccccgctgcagctgccctatctggccgtcctagcggccgccgtgggtgtgatcctc
gttatggccgtgctctgcaaccgtgccgccttccaccaggaccacatgggcctggcctgc
tacgcgcttatcgccgtggtgctggccgtccaggtggtgggcctgctgctgccccagccg
cgcagtgcctccgagggcatctggtggactgtgtttttcatctatacgatctacacgctc
ctgcccgtgcgcatgcgggctgcggtactcagcggggtgctcctgtccgccctccacctg
gccatcgccctgcgcaccaacgcccaggatcagttcctgctcaagcagctcgtctccaat
gtcctcattttctcctgcaccaacatcgtgggtgtgtgcacccactacccggctgaggtc
tcgcagagacaggccttccaggagacccgggagtgcatccaggcgcggctccactcgcag
cgggagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcacgttgccatg
gagatgaaagctgacatcaacgccaaacaggaggatatgatgttccataagatttacatc
cagaaacatgacaacgtgagcatcctgtttgctgacatcgagggtttcaccagcctggca
tcccagtgcactgcccaggagctggtcatgaccctcaatgagctcttcgcccgcttcgac
aagctggctgcggagaatcactgtttacgtattaagatcctgggagattgttattactgt
gtctcagggctgcctgaagccagggctgaccacgcccactgctgcgtggagatgggcatg
gacatgatcgaggccatctcgctggtccgggaggtgacaggtgtgaacgtgaacatgcgt
gtgggaattcacagcgggagagtgcactgcggtgtcctcggcctcaggaagtggcagttc
gatgtctggtctaacgatgtcacactggccaaccacatggaggctggaggcaaggcggga
cgcatccacatcaccaaggccacactcaactacttgaatggtgactacgaggtggagcca
ggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagacctttctcatc
ctgcgctgcacccagaagcggaaagaagaaaaggccatgattgccaagatgaaccgccag
agaaccaactccatcgggcacaacccgcctcactggggggccgagcgccccttctataac
cacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaagaccccaag
gacaagaatgcccaggaaagttcgaaccctgaggatgaagtggatgaatttctgggccgt
gccattgatgccaggagcatcgacaggctgcgatccgaacatgtgcgcaagttcctcttg
accttcagggagcctgacttagagaagaagtactccaagcaagtggatgaccgattcggt
gcctacgtggcctgtgcctcgctcgtcttcctcttcatctgctttgtccagatcaccgtc
gtgccccactccgtgttcatgttgagtttctacctgacctgtttcctgctgctgaccttg
gtggtgtttgtgtccgtgatctattcttgcgtgaagctcttcccggccccgctgcagacc
ctctccaggaagatcgtgaggtccaagatgaacagcaccctagtgggggtgttcaccatc
accctcgtgttcctgtcggctttcgtcaacatgttcacgtgcaactccaaggacctgttt
ggctgcctgggggacgagcacaacatcagtgccagtcaggtcaacgcgtgccacgtggtg
gagtcggccgtcaactacagtctgggtgatgagcagggcttctgcggcagctcctggccc
aactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcctgctcc
gtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcatc
tacgtgctcgtcgttgaggtgcccggtgtcacactctttgacaatgccgacctcctggtc
acggccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcatccgacc
aaggtggcgctgaaggtggtgacgcccgtcatcatctctgtcttcgtgctggccctgtac
ctgcacgcccagcaggtggagtccactgcccgcctcgacttcctctggaaacttcaggcc
acagaggagaaggaggagatggaggagctgcaggcttacaaccggcggctgctgcacaat
attctgcccaaggacgtggccgcacacttcctggcccgtgaacggcgcaacgacgagctc
tactatcagtcgtgcgagtgcgtggccgtcatgttcgcctccatcgccaacttctccgag
ttctacgtggaactggaggccaacaacgagggcgtcgagtgcctgcggctgctcaacgag
atcatcgcagactttgacgagatcattagtgaggaccggttcaggcagctggaaaagatc
aagaccatcggcagcacctacatggccgcctcgggcctcaatgactccacctacgacaag
gtgggcaagacccacatcaaagccctggccgacttcgccatgaagttgatggaccaaatg
aagtacatcaacgagcactctttcaacaacttccagatgaagatcgggctcaatattggc
cccgtggtggcgggcgtgatcggagcccgcaagcctcagtacgacatctggggcaatacg
gtgaacgtggccagccgcatggacagcaccggtgtgcccgaccgcatccaggtcaccaca
gacatgtaccaggtgctggccgccaacacgtaccagctggagtgccggggtgtggtcaag
gtcaagggcaaaggcgagatgatgacctacttcctcaacggagggcccccgcccagttag

DBGET integrated database retrieval system