KEGG   Capra hircus (goat): 102169137
Entry
102169137         CDS       T02910                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04210  Apoptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04926  Relaxin signaling pathway
chx04931  Insulin resistance
chx05132  Salmonella infection
chx05134  Legionellosis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102169137 (NFKBIA)
   04668 TNF signaling pathway
    102169137 (NFKBIA)
   04024 cAMP signaling pathway
    102169137 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102169137 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102169137 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    102169137 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    102169137 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    102169137 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    102169137 (NFKBIA)
   04660 T cell receptor signaling pathway
    102169137 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    102169137 (NFKBIA)
   04659 Th17 cell differentiation
    102169137 (NFKBIA)
   04657 IL-17 signaling pathway
    102169137 (NFKBIA)
   04662 B cell receptor signaling pathway
    102169137 (NFKBIA)
   04062 Chemokine signaling pathway
    102169137 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102169137 (NFKBIA)
   04926 Relaxin signaling pathway
    102169137 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102169137 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102169137 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169137 (NFKBIA)
   05203 Viral carcinogenesis
    102169137 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102169137 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102169137 (NFKBIA)
   05215 Prostate cancer
    102169137 (NFKBIA)
   05222 Small cell lung cancer
    102169137 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102169137 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102169137 (NFKBIA)
   05135 Yersinia infection
    102169137 (NFKBIA)
   05134 Legionellosis
    102169137 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102169137 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    102169137 (NFKBIA)
   05161 Hepatitis B
    102169137 (NFKBIA)
   05160 Hepatitis C
    102169137 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    102169137 (NFKBIA)
   05164 Influenza A
    102169137 (NFKBIA)
   05162 Measles
    102169137 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    102169137 (NFKBIA)
   05163 Human cytomegalovirus infection
    102169137 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102169137 (NFKBIA)
   05169 Epstein-Barr virus infection
    102169137 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102169137 (NFKBIA)
   05140 Leishmaniasis
    102169137 (NFKBIA)
   05142 Chagas disease
    102169137 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102169137 (NFKBIA)
   04131 Membrane trafficking [BR:chx04131]
    102169137 (NFKBIA)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102169137 (NFKBIA)
Membrane trafficking [BR:chx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102169137 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 102169137
NCBI-ProteinID: XP_017921998
UniProt: A0A452E2Q3
LinkDB
Position
21
AA seq 314 aa
MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQQLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLSQLTLENLQTLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc
aagaaggagaggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg
cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcgctcaccatggaagtggtccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc
actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagccccggggaacccagcagctccactccattctgcaagccaccaac
tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag
ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc
ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctgttgaagtgtggg
gctgatgtcaacagagtcacctaccagggctactccccataccagctcacgtggggccgc
cccagcacccggatacagcagcagctgagccagctgaccctagagaaccttcagacactg
ccagagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt
ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

KEGG   Capra hircus (goat): 102181421
Entry
102181421         CDS       T02910                                 

Gene name
NFKBIB
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
chx  Capra hircus (goat)
Pathway
chx04062  Chemokine signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04722  Neurotrophin signaling pathway
chx04920  Adipocytokine signaling pathway
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05162  Measles
chx05164  Influenza A
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102181421 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    102181421 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    102181421 (NFKBIB)
   04660 T cell receptor signaling pathway
    102181421 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    102181421 (NFKBIB)
   04659 Th17 cell differentiation
    102181421 (NFKBIB)
   04662 B cell receptor signaling pathway
    102181421 (NFKBIB)
   04062 Chemokine signaling pathway
    102181421 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102181421 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102181421 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102181421 (NFKBIB)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102181421 (NFKBIB)
   05164 Influenza A
    102181421 (NFKBIB)
   05162 Measles
    102181421 (NFKBIB)
   05169 Epstein-Barr virus infection
    102181421 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102181421 (NFKBIB)
   05140 Leishmaniasis
    102181421 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102181421 (NFKBIB)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102181421 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 102181421
NCBI-ProteinID: XP_017917859
UniProt: A0A452FQW4
LinkDB
Position
18
AA seq 358 aa
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILEEASAVEKLYAAGANL
LVAERGGHTALHLSCRVGAHACARVLLQPRPQHSRGAPKTYLAQGSDHTPDTDHTPIALY
SEPDVEKEEDESEEDWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLQEAGADLNKPEPTC
GRSPLHLAVEAQAADVLELLLKAGADPAVRMYGGRTPLGSAALRPSAILARLLRAHGAPE
PEDEDKPGPCSSSSSSSSSDSESGDEGDEYDDIVVHSGRSPNQLPPTPASKPLPDDPI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggccggggtcgcgtgtttggggaaagctgcggacgccgatgaatggtgcgacagcggc
ctgggctctctgggtccggacgcggcggcccccggaggacctgggctaggcgcggagctg
ggcccggggctgtcgtgggcgcccctcgttttcggctacgtcactgaggatggcgacacg
gcactgcacttggcggtgattcatcagcatgagcccttcctggacttcctcctaggcttt
gcagctggtaccgagtacctggacctgcagaatgacttgggccagacggccctgcacctg
gcggccatcctggaggaggcgtccgcggtagagaagttgtatgcagcaggtgccaatttg
ctggtggcggagcgtggaggccacacggcgctgcacctgtcctgccgcgtgggagcccac
gcctgcgctcgcgtgctgctccagcctcgcccccagcactccaggggagcccccaagacc
tacctcgctcagggctctgaccatacccctgacaccgaccacacccctattgccctgtac
tctgaacctgacgtggagaaagaagaggatgagagtgaagaggactggaaactgcagcta
gaggctgaaaactatgagggccacaccccactccacgtggctgtcatccacaaagatgca
gagatggtccgactgctccaggaggcaggagctgacctcaacaaacccgagcccacctgc
ggccgaagccccctgcacttggccgtggaggcccaagcagctgatgtactggagcttctc
ctgaaggccggtgctgaccccgctgtccgcatgtatggtggccgcaccccactcggcagt
gccgcgcttcggcccagcgccatccttgcccgcctcctccgtgctcacggagccccagag
cccgaggacgaggacaagcctggcccctgcagcagcagcagcagcagcagcagtagcgac
agcgagagcggggatgagggcgatgaatacgacgacatcgtagtccacagtggccggagc
cccaaccagctacctcccaccccagcgtcaaaaccgctccctgacgaccccatctga

DBGET integrated database retrieval system