KEGG   Capra hircus (goat): 102169417
Entry
102169417         CDS       T02910                                 

Gene name
ITGB3
Definition
(RefSeq) integrin subunit beta 3
  KO
K06493  integrin beta 3
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04145  Phagosome
chx04151  PI3K-Akt signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04512  ECM-receptor interaction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04640  Hematopoietic cell lineage
chx04810  Regulation of actin cytoskeleton
chx04919  Thyroid hormone signaling pathway
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05168  Herpes simplex virus 1 infection
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05410  Hypertrophic cardiomyopathy
chx05412  Arrhythmogenic right ventricular cardiomyopathy
chx05414  Dilated cardiomyopathy
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102169417 (ITGB3)
   04151 PI3K-Akt signaling pathway
    102169417 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102169417 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102169417 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102169417 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102169417 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102169417 (ITGB3)
   04611 Platelet activation
    102169417 (ITGB3)
   04613 Neutrophil extracellular trap formation
    102169417 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102169417 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102169417 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102169417 (ITGB3)
   05205 Proteoglycans in cancer
    102169417 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102169417 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    102169417 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102169417 (ITGB3)
   05414 Dilated cardiomyopathy
    102169417 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102169417 (ITGB3)
   05163 Human cytomegalovirus infection
    102169417 (ITGB3)
   05165 Human papillomavirus infection
    102169417 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102169417 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102169417 (ITGB3)
   04515 Cell adhesion molecules [BR:chx04515]
    102169417 (ITGB3)
   04090 CD molecules [BR:chx04090]
    102169417 (ITGB3)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102169417 (ITGB3)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102169417 (ITGB3)
Cell adhesion molecules [BR:chx04515]
 Integrins
  Integrin beta subunits
   102169417 (ITGB3)
CD molecules [BR:chx04090]
 Proteins
  102169417 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 102169417
NCBI-ProteinID: XP_017920798
LinkDB
Position
19
AA seq 784 aa
MRARRLWAVVLVVGALAGVGVGGPNICATRGVSSCQQCLAVSPMCAWCSDEALPPGSPRC
NLKENLLKDNCAPESIEFPISEARILEARPLSDKGTGDSSQITQVSPQRIALRLRPDDSK
IFSVQVRQVEDYPVDIYYLMDLSYSMKDDLRNIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPEAIRNPCYDMKATCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGND
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTESVVNLYQNYSELIPGTTVGVLSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQKKEKSFTIKPVGFKDSLTVQVTFDCDCACQAEAEPYSHRCNNGNGTFECG
VCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPICSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFNRGALNEENTCNRYCRDE
IEPVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcgagcgcggcggctctgggccgtggtgctggtggtgggggcgctggcgggcgtcggc
gtcggagggcccaacatctgtgccacacgaggtgtgagctcctgccagcaatgtctggct
gtgagtcccatgtgtgcctggtgctcagatgaggcgctgcctccaggctcgccccgctgt
aacctgaaggagaacctgctgaaggataactgcgccccagagtccatcgagttcccgatc
agtgaggccagaatcctggaggccaggcccctcagtgacaagggcactggagacagctcc
cagattacccaagtcagtccccagaggattgccctccgcctacggccagatgattcgaag
attttctccgtccaagttcggcaggtggaagattaccctgtggacatctactacttaatg
gacttgtcttactccatgaaggatgacctgcggaacatccagaacctgggtaccaagctg
gcctcccagatgcgtaagctcaccagtaacctgcggattggcttcggggcctttgtggac
aagcccgtgtcaccatacatgtatatttctccaccagaggctatcagaaacccttgctat
gatatgaaggctacctgtttgcccatgtttggctacaaacatgtgctgacactaactgac
caggtgacccgcttcaatgaggaggtgaagaagcagagtgtgtcacggaaccgagatgcc
ccagagggtggtttcgatgccattatgcaggctaccgtctgtgatgagaagattggctgg
aggaatgatgcctcccacttgctggtgtttaccactgatgccaagacccatatagcgctg
gatggaaggctggcaggcatcgtccagcccaatgacgggcagtgtcatgtgggcaatgac
aaccattattctgcctccactaccatggattatccctccttggggctgatgactgagaag
ctatcccagaaaaacatcaatttgatctttgcagtgactgaaagtgtagtcaatctctac
cagaactatagtgagctcatcccagggaccacagtgggggttctgtctactgattccagc
aatgttctccagctcattgtggatgcttatgggaaaatccgctctaaagtagagctggaa
gtgcgtgacctccccgaggagctgtccttatccttcaacgccacctgtctcaacaatgaa
gtcatcccaggcctgaagtcttgtgtcggactcaagattggagacacggtgagcttcagc
attgaggccaaagtgcgtggctgtccccagaagaaggagaagtccttcaccatcaagcct
gtgggcttcaaagacagcctcactgtgcaggtcactttcgactgtgactgtgcctgccag
gccgaggctgagccttacagccaccgctgcaacaatggcaatgggacctttgagtgtggg
gtgtgccgctgtgggcctggctggctggggtcccagtgcgagtgctcggaagaggactac
cgcccctcgcagcaggacgagtgcagcccccgggagggccagcccatctgcagccagcgg
ggcgagtgtctctgtggccagtgcgtctgccacagcagtgactttggcaagatcacgggc
aagtactgtgagtgtgatgacttctcctgtgtccgctacaagggggagatgtgctcaggc
cacggccagtgcagctgtggggactgcctatgtgactccgactggaccggctactactgc
aactgtaccacacgcacggatacctgcatgtccagcaacgggttgctgtgcagcgggcgc
ggcaagtgcgagtgcggcagctgtgtctgcatccagcctggctcctatggggacacctgt
gagaagtgtcccacctgccctgatgcctgcacctttaagaaggagtgtgtggaatgtaag
aagtttaaccggggagccctcaacgaggaaaatacctgcaaccgttattgtcgtgatgag
attgagcctgtgaaggaacttaaggacactggcaaggatgctgtgaattgtacttacaag
aatgaggatgactgtgtcgtcagattccagtactacgaagactccagtggaaagtccatt
ttgtatgtggtggaagagccagagtgtcccaagggccctgacatcctggtggtcttgctc
tccgtgatgggggccattctgctcatcggccttgcgactctgctcatctggaagctcctc
atcaccatccatgaccggaaggagtttgctaaatttgaagaagagagagccagagccaaa
tgggacactgccaacaacccactgtataaagaggccacgtccaccttcaccaacatcacc
taccggggcacttaa

DBGET integrated database retrieval system