KEGG   Capra hircus (goat): 102169621
Entry
102169621         CDS       T02910                                 

Gene name
TP53, p53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04010  MAPK signaling pathway
chx04071  Sphingolipid signaling pathway
chx04110  Cell cycle
chx04115  p53 signaling pathway
chx04137  Mitophagy - animal
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04216  Ferroptosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04722  Neurotrophin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102169621 (TP53)
   04310 Wnt signaling pathway
    102169621 (TP53)
   04071 Sphingolipid signaling pathway
    102169621 (TP53)
   04151 PI3K-Akt signaling pathway
    102169621 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102169621 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102169621 (TP53)
   04210 Apoptosis
    102169621 (TP53)
   04216 Ferroptosis
    102169621 (TP53)
   04115 p53 signaling pathway
    102169621 (TP53)
   04218 Cellular senescence
    102169621 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102169621 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102169621 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102169621 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169621 (TP53)
   05202 Transcriptional misregulation in cancer
    102169621 (TP53)
   05206 MicroRNAs in cancer
    102169621 (TP53)
   05205 Proteoglycans in cancer
    102169621 (TP53)
   05203 Viral carcinogenesis
    102169621 (TP53)
   05230 Central carbon metabolism in cancer
    102169621 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102169621 (TP53)
   05212 Pancreatic cancer
    102169621 (TP53)
   05225 Hepatocellular carcinoma
    102169621 (TP53)
   05226 Gastric cancer
    102169621 (TP53)
   05214 Glioma
    102169621 (TP53)
   05216 Thyroid cancer
    102169621 (TP53)
   05220 Chronic myeloid leukemia
    102169621 (TP53)
   05217 Basal cell carcinoma
    102169621 (TP53)
   05218 Melanoma
    102169621 (TP53)
   05219 Bladder cancer
    102169621 (TP53)
   05215 Prostate cancer
    102169621 (TP53)
   05213 Endometrial cancer
    102169621 (TP53)
   05224 Breast cancer
    102169621 (TP53)
   05222 Small cell lung cancer
    102169621 (TP53)
   05223 Non-small cell lung cancer
    102169621 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102169621 (TP53)
   05014 Amyotrophic lateral sclerosis
    102169621 (TP53)
   05016 Huntington disease
    102169621 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102169621 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102169621 (TP53)
   05161 Hepatitis B
    102169621 (TP53)
   05160 Hepatitis C
    102169621 (TP53)
   05162 Measles
    102169621 (TP53)
   05168 Herpes simplex virus 1 infection
    102169621 (TP53)
   05163 Human cytomegalovirus infection
    102169621 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102169621 (TP53)
   05169 Epstein-Barr virus infection
    102169621 (TP53)
   05165 Human papillomavirus infection
    102169621 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102169621 (TP53)
   01522 Endocrine resistance
    102169621 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102169621 (TP53)
   03036 Chromosome and associated proteins [BR:chx03036]
    102169621 (TP53)
   03400 DNA repair and recombination proteins [BR:chx03400]
    102169621 (TP53)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102169621 (TP53)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102169621 (TP53)
DNA repair and recombination proteins [BR:chx03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102169621 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 102169621
NCBI-ProteinID: XP_005693587
UniProt: A0A452G0A3
LinkDB
Position
19
AA seq 382 aa
MEESQAELGVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYSEDVVTWLDECPNE
APQMPEPPAQAALAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSPSLNK
LFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPP
QHLIRVEGNLRAEYFDDRNTFRHSVVVPYESPEIESECTTIHYNFMCNSSCMGGMNRRPI
LTIITLEDSRGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSTKRALPSS
TSSSPQQKKKPLDGEYFTLQIRGRKRFEMFRELNEALELMDAQAGREPGESRAHSSHLKS
KKGPSPSCHKKPMLKREGPDSD
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaagaatcgcaggcagaactcggtgtggagccccctctgagtcaggagacattttcc
gacttgtggaacctacttcctgaaaacaaccttctgtcctccgagctctccgcacccgtg
gatgacctgctcccgtactcagaagatgttgtcacctggctggatgaatgtccgaatgaa
gcgccccaaatgccagagcctcctgcccaagctgccctggcaccagccacctcctggccc
ctgtcgtcctttgtcccctcccagaagacctaccctggcaactacggtttccgtctcggg
ttcctgcattccggaacagccaagtctgtgacctgcacgtattccccttccctcaacaag
ctgttctgccagctggccaagacctgcccagtgcagctatgggtcgactcgccgcccccg
cccggcacccgcgtccgcgccatggccatctacaagaagctggagcacatgacggaggtt
gtgaggcgctgtccccaccatgagcgctcctctgactatagcgatggtctggccccgcct
cagcaccttatccgggtggaagggaatttacgcgcggagtatttcgacgaccggaacacc
tttagacacagtgtggtggtgccctatgagtcccccgagatcgagtctgagtgcaccacc
atccactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcggcccatc
ctcaccatcatcacactggaagactctcgtggtaacctgctgggacggaacagctttgag
gtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaagaagaaaattttcgcaag
aaggggcagtcttgccccgagccaccccctgggagcactaagcgagcactgcccagcagc
accagctcctctccacagcaaaagaagaaaccactggatggagaatatttcactcttcag
atccgtgggcgtaaacgctttgagatgttccgagagctgaatgaggccttggagctgatg
gatgctcaggctggaagggaaccaggggaaagcagggctcattctagccacctgaagtct
aagaaggggccttctccctcctgccataaaaaaccaatgctcaagagagaagggcctgac
tcagactga

DBGET integrated database retrieval system