Capra hircus (goat): 102169621 Help Entry 102169621         CDS       T02910                                  Gene name TP53, p53 Definition (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism chx  Capra hircus (goat) Pathway chx01522   Endocrine resistance chx01524   Platinum drug resistance chx04010   MAPK signaling pathway chx04071   Sphingolipid signaling pathway chx04110   Cell cycle chx04115   p53 signaling pathway chx04137   Mitophagy - animal chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04211   Longevity regulating pathway chx04216   Ferroptosis chx04218   Cellular senescence chx04310   Wnt signaling pathway chx04722   Neurotrophin signaling pathway chx04919   Thyroid hormone signaling pathway chx05012   Parkinson disease chx05014   Amyotrophic lateral sclerosis chx05016   Huntington disease chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05212   Pancreatic cancer chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05217   Basal cell carcinoma chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05222   Small cell lung cancer chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102169621 (TP53)    04310 Wnt signaling pathway     102169621 (TP53)    04071 Sphingolipid signaling pathway     102169621 (TP53)    04151 PI3K-Akt signaling pathway     102169621 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102169621 (TP53)   09143 Cell growth and death    04110 Cell cycle     102169621 (TP53)    04210 Apoptosis     102169621 (TP53)    04216 Ferroptosis     102169621 (TP53)    04115 p53 signaling pathway     102169621 (TP53)    04218 Cellular senescence     102169621 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102169621 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102169621 (TP53)   09149 Aging    04211 Longevity regulating pathway     102169621 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102169621 (TP53)    05202 Transcriptional misregulation in cancer     102169621 (TP53)    05206 MicroRNAs in cancer     102169621 (TP53)    05205 Proteoglycans in cancer     102169621 (TP53)    05203 Viral carcinogenesis     102169621 (TP53)    05230 Central carbon metabolism in cancer     102169621 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102169621 (TP53)    05212 Pancreatic cancer     102169621 (TP53)    05225 Hepatocellular carcinoma     102169621 (TP53)    05226 Gastric cancer     102169621 (TP53)    05214 Glioma     102169621 (TP53)    05216 Thyroid cancer     102169621 (TP53)    05220 Chronic myeloid leukemia     102169621 (TP53)    05217 Basal cell carcinoma     102169621 (TP53)    05218 Melanoma     102169621 (TP53)    05219 Bladder cancer     102169621 (TP53)    05215 Prostate cancer     102169621 (TP53)    05213 Endometrial cancer     102169621 (TP53)    05224 Breast cancer     102169621 (TP53)    05222 Small cell lung cancer     102169621 (TP53)    05223 Non-small cell lung cancer     102169621 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102169621 (TP53)    05014 Amyotrophic lateral sclerosis     102169621 (TP53)    05016 Huntington disease     102169621 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102169621 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102169621 (TP53)    05161 Hepatitis B     102169621 (TP53)    05160 Hepatitis C     102169621 (TP53)    05162 Measles     102169621 (TP53)    05168 Herpes simplex virus 1 infection     102169621 (TP53)    05163 Human cytomegalovirus infection     102169621 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102169621 (TP53)    05169 Epstein-Barr virus infection     102169621 (TP53)    05165 Human papillomavirus infection     102169621 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102169621 (TP53)    01522 Endocrine resistance     102169621 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:chx03000]     102169621 (TP53)    03036 Chromosome and associated proteins [BR:chx03036]     102169621 (TP53)    03400 DNA repair and recombination proteins [BR:chx03400]     102169621 (TP53) Transcription factors [BR:chx03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102169621 (TP53) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102169621 (TP53) DNA repair and recombination proteins [BR:chx03400]  Eukaryotic type   Check point factors    Other check point factors     102169621 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  102169621 NCBI-ProteinID:  XP_005693587 UniProt:  A0A452G0A3 LinkDB All DBs Position 19 AA seq 382 aa AA seqDB search MEESQAELGVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYSEDVVTWLDECPNE APQMPEPPAQAALAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSPSLNK LFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPP QHLIRVEGNLRAEYFDDRNTFRHSVVVPYESPEIESECTTIHYNFMCNSSCMGGMNRRPI LTIITLEDSRGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSTKRALPSS TSSSPQQKKKPLDGEYFTLQIRGRKRFEMFRELNEALELMDAQAGREPGESRAHSSHLKS KKGPSPSCHKKPMLKREGPDSD NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt atggaagaatcgcaggcagaactcggtgtggagccccctctgagtcaggagacattttcc gacttgtggaacctacttcctgaaaacaaccttctgtcctccgagctctccgcacccgtg gatgacctgctcccgtactcagaagatgttgtcacctggctggatgaatgtccgaatgaa gcgccccaaatgccagagcctcctgcccaagctgccctggcaccagccacctcctggccc ctgtcgtcctttgtcccctcccagaagacctaccctggcaactacggtttccgtctcggg ttcctgcattccggaacagccaagtctgtgacctgcacgtattccccttccctcaacaag ctgttctgccagctggccaagacctgcccagtgcagctatgggtcgactcgccgcccccg cccggcacccgcgtccgcgccatggccatctacaagaagctggagcacatgacggaggtt gtgaggcgctgtccccaccatgagcgctcctctgactatagcgatggtctggccccgcct cagcaccttatccgggtggaagggaatttacgcgcggagtatttcgacgaccggaacacc tttagacacagtgtggtggtgccctatgagtcccccgagatcgagtctgagtgcaccacc atccactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcggcccatc ctcaccatcatcacactggaagactctcgtggtaacctgctgggacggaacagctttgag gtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaagaagaaaattttcgcaag aaggggcagtcttgccccgagccaccccctgggagcactaagcgagcactgcccagcagc accagctcctctccacagcaaaagaagaaaccactggatggagaatatttcactcttcag atccgtgggcgtaaacgctttgagatgttccgagagctgaatgaggccttggagctgatg gatgctcaggctggaagggaaccaggggaaagcagggctcattctagccacctgaagtct aagaaggggccttctccctcctgccataaaaaaccaatgctcaagagagaagggcctgac tcagactga

DBGET integrated database retrieval system