KEGG   Capra hircus (goat): 102169650
Entry
102169650         CDS       T02910                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04340  Hedgehog signaling pathway
chx04371  Apelin signaling pathway
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04530  Tight junction
chx04630  JAK-STAT signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx05160  Hepatitis C
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102169650 (CCND1)
   04340 Hedgehog signaling pathway
    102169650 (CCND1)
   04390 Hippo signaling pathway
    102169650 (CCND1)
   04371 Apelin signaling pathway
    102169650 (CCND1)
   04630 JAK-STAT signaling pathway
    102169650 (CCND1)
   04068 FoxO signaling pathway
    102169650 (CCND1)
   04151 PI3K-Akt signaling pathway
    102169650 (CCND1)
   04152 AMPK signaling pathway
    102169650 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102169650 (CCND1)
   04115 p53 signaling pathway
    102169650 (CCND1)
   04218 Cellular senescence
    102169650 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102169650 (CCND1)
   04530 Tight junction
    102169650 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102169650 (CCND1)
   04921 Oxytocin signaling pathway
    102169650 (CCND1)
   04919 Thyroid hormone signaling pathway
    102169650 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169650 (CCND1)
   05206 MicroRNAs in cancer
    102169650 (CCND1)
   05205 Proteoglycans in cancer
    102169650 (CCND1)
   05203 Viral carcinogenesis
    102169650 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102169650 (CCND1)
   05212 Pancreatic cancer
    102169650 (CCND1)
   05225 Hepatocellular carcinoma
    102169650 (CCND1)
   05226 Gastric cancer
    102169650 (CCND1)
   05214 Glioma
    102169650 (CCND1)
   05216 Thyroid cancer
    102169650 (CCND1)
   05221 Acute myeloid leukemia
    102169650 (CCND1)
   05220 Chronic myeloid leukemia
    102169650 (CCND1)
   05218 Melanoma
    102169650 (CCND1)
   05219 Bladder cancer
    102169650 (CCND1)
   05215 Prostate cancer
    102169650 (CCND1)
   05213 Endometrial cancer
    102169650 (CCND1)
   05224 Breast cancer
    102169650 (CCND1)
   05222 Small cell lung cancer
    102169650 (CCND1)
   05223 Non-small cell lung cancer
    102169650 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102169650 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102169650 (CCND1)
   04934 Cushing syndrome
    102169650 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102169650 (CCND1)
   05162 Measles
    102169650 (CCND1)
   05160 Hepatitis C
    102169650 (CCND1)
   05163 Human cytomegalovirus infection
    102169650 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102169650 (CCND1)
   05169 Epstein-Barr virus infection
    102169650 (CCND1)
   05165 Human papillomavirus infection
    102169650 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102169650 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102169650
NCBI-ProteinID: XP_017898760
UniProt: A0A452E483
LinkDB
Position
29
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCVYTDNSIRPDELLHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAAQGLHLGSANGFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggaaaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgagtgctgcgggctatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgtatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcgtctacactgacaactccatccggcccgacgagctgctgcacatg
gagctggtcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaaaatgccggtggccgaggagaacaagcagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccaccc
tccatggtggctgccgggagcgtggtggccgcggcgcaaggcctgcacctgggaagcgcc
aacggcttcctctcctatcaccgcctgacacggttcctctccaaggtgatcagatgtgac
ccggactgcctccgcgcctgccaggagcagattgaagccctcctggagtccagccttcgc
caggcccagcagcagaacttggaccccaaagccgcggaggaggaggaggaagaggaggag
gtggacctggcctgcacgcccaccgacgtgcgcgacgtgaacatttga

DBGET integrated database retrieval system