KEGG   Capra hircus (goat): 102169966
Entry
102169966         CDS       T02910                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04621  NOD-like receptor signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
Module
chx_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102169966 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102169966 (PLCB2)
   04310 Wnt signaling pathway
    102169966 (PLCB2)
   04371 Apelin signaling pathway
    102169966 (PLCB2)
   04020 Calcium signaling pathway
    102169966 (PLCB2)
   04070 Phosphatidylinositol signaling system
    102169966 (PLCB2)
   04072 Phospholipase D signaling pathway
    102169966 (PLCB2)
   04071 Sphingolipid signaling pathway
    102169966 (PLCB2)
   04022 cGMP-PKG signaling pathway
    102169966 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102169966 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102169966 (PLCB2)
   04613 Neutrophil extracellular trap formation
    102169966 (PLCB2)
   04621 NOD-like receptor signaling pathway
    102169966 (PLCB2)
   04062 Chemokine signaling pathway
    102169966 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    102169966 (PLCB2)
   04922 Glucagon signaling pathway
    102169966 (PLCB2)
   04929 GnRH secretion
    102169966 (PLCB2)
   04912 GnRH signaling pathway
    102169966 (PLCB2)
   04915 Estrogen signaling pathway
    102169966 (PLCB2)
   04921 Oxytocin signaling pathway
    102169966 (PLCB2)
   04926 Relaxin signaling pathway
    102169966 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    102169966 (PLCB2)
   04918 Thyroid hormone synthesis
    102169966 (PLCB2)
   04919 Thyroid hormone signaling pathway
    102169966 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    102169966 (PLCB2)
   04916 Melanogenesis
    102169966 (PLCB2)
   04924 Renin secretion
    102169966 (PLCB2)
   04925 Aldosterone synthesis and secretion
    102169966 (PLCB2)
   04927 Cortisol synthesis and secretion
    102169966 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102169966 (PLCB2)
   04270 Vascular smooth muscle contraction
    102169966 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    102169966 (PLCB2)
   04971 Gastric acid secretion
    102169966 (PLCB2)
   04972 Pancreatic secretion
    102169966 (PLCB2)
   04973 Carbohydrate digestion and absorption
    102169966 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102169966 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102169966 (PLCB2)
   04725 Cholinergic synapse
    102169966 (PLCB2)
   04728 Dopaminergic synapse
    102169966 (PLCB2)
   04726 Serotonergic synapse
    102169966 (PLCB2)
   04720 Long-term potentiation
    102169966 (PLCB2)
   04730 Long-term depression
    102169966 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    102169966 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    102169966 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    102169966 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102169966 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102169966 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102169966 (PLCB2)
   05016 Huntington disease
    102169966 (PLCB2)
   05017 Spinocerebellar ataxia
    102169966 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    102169966 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102169966 (PLCB2)
   04934 Cushing syndrome
    102169966 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102169966 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102169966 (PLCB2)
   05142 Chagas disease
    102169966 (PLCB2)
   05143 African trypanosomiasis
    102169966 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102169966 (PLCB2)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102169966 (PLCB2)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102169966 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102169966 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 Gp58
Other DBs
NCBI-GeneID: 102169966
NCBI-ProteinID: XP_017909945
UniProt: A0A452DUW1
LinkDB
Position
10
AA seq 1186 aa
MSLLNPVLLPPTVKAYLSQGERFIKWDDETTTASPVILRVDPKGYYLYWTYQSKEMELLD
ITSIRDTRFGKFAKMPKSQKLREVFNMNTPDNFLLKTLTVVSGPDMVDLTFHNFVSYKEN
VGKDWAEDVLALAKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKRV
EAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHSKAKPYMTKEHL
AKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPENS
VLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCW
KGKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMA
EYCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKEPDGEA
EGSSPPNGPVGEDTVWAGEEGAELEEEEVEEEEEESGNLDEEEIKKMQSDEGTAGLEVTA
YKEMSSLVNYIQPTKFISFELSAQKNRSYVISSFTELKAYDLLSKSSVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RSDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKL
SPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPISALNSGYHHLCL
HNESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKKAVKLKEAMGGQLE
GPFPLGNHPASQVNGASAPTSNGSAAAGAKAREEATKEVAEPQTASLEELRELKGVVKLQ
RRQEKELRELGRRGVRRWEELLQRGAAQLAGLGPPGAGVSGGCRGRKLGPGKGSRKKRTL
PGEDTAGAASAEGPEGEDVRLRELRDRLELELLQLGEEQCECVLKLKEQHAAQQMTKMME
LAREKQAAERKTLKETLETDTKEMKKKLEAKRLERIQAMMKVTTDKMAQERLKREINNSH
IQEVVQVINQMKENLERHQEKLEEKQAACLEQIQEMEKQFQQEAMAEYEVKMKGLEMEVK
ESVRTCLRACFPSEEEDKPERPCVVSRELCEQDILTEQAETQESHL
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgtctcttctcaaccctgtcctgctgccccccacagtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaacgacgacagcctctccggttatcctccgtgtg
gatcccaagggctactacttgtactggacatatcagagtaaggagatggagcttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggaagtcttcaacatgaacacccccgacaacttcctgctgaagacgctcacagta
gtatctggccctgacatggtggacctcaccttccataacttcgtctcctacaaggagaac
gtgggcaaggactgggctgaagacgtattggctctggccaagcacccgctgacggccaac
gcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagcttaaccct
gaggggaagattcccgtgaagaattttttccagatgttccctgctgaccgcaagcgggtg
gaagctgccctcagcgcctgccacctccccaaaggcaagaacgatgccatcaatcccgag
gacttcccagaatccgtgtacaagagcttcctcatgagcctctgtcctcggccggaaata
gatgagatcttcacttcctaccactccaaggccaaaccgtatatgactaaggagcacctg
gccaaattcatcaaccagaaacagcgtgactccaggctcaattccctgctgtttccgcca
gcgcggcctgaccaggtgcagggcctcatcgacaagtatgagcccagcggcatcaatgtg
cagcggggccagctgtcccctgagggcatggtgtggtttctctgcgggccggagaacagt
gtgctggcccaggacaagctgctgctgcaccacgacatgacccagccactcaaccattac
ttcatcaactcctcccacaacacctacctgacagctggccagttctcaggcctctcctct
gctgagatgtaccgccaagtgctgctggcaggctgccgctgcgtggagctggactgctgg
aaggggaagccccccgacgaggagcccatcatcacccacggtttcaccatgaccacagac
atctatttcaaggaagcaatcgaagccattgcagaaagtgcctttaagacctccccttat
ccggtcatcctgtcatttgaaaaccacgtggactcaccccgccaacaggctaagatggcc
gagtactgccggacgatgtttggggatatgctgctcacagaacccctggagaagttcccg
ctgaaacctggcatccccctgcccagccctgaggatctccgaggcaagatcctaataaag
aacaagaagaaccagttttctggccctgcatcccccagcaaggagccggatggggaggct
gagggtagcagcccacccaatggccctgtgggtgaggatacagtgtgggctggtgaggaa
ggggctgagttggaagaggaggaggtggaagaggaagaggaggagtcggggaacctggat
gaagaagagataaagaagatgcaatcagatgagggcacagcgggcctggaggtgacggcc
tacaaggagatgtccagcctagtcaattacatccagcccaccaagttcatctccttcgag
ctctctgcccagaagaaccgaagttatgttatctcctccttcacggagctcaaggcttac
gacctgctctccaagtcctcagtgcagtttgtggactacaacaagcgccaaatgagccgc
atctaccccaagggtacccgcatggactcctccaactacatgccccagatgttctggaat
gctggttgtcagatggttgccctcaacttccagacgatggacctgcccatgcagcagaac
atggcgcttttcgagttcaacgggcagagtggctacctcctcaagcatgagttcatgcgt
cggtcggacaagcagttcaatcccttctcagtggaccgcatcgacgtggtggtagccacc
accctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgcacctat
gtggaagtggagctgtttggccttccgggggatcccaagaggcgctatcgcaccaagctg
tcacccagtaccaactccatcaatccggtctggaaggaggagccctttgtctttgagaag
atcttgatgcctgagctggcttccctcagagtcgctgtgatggaggagggcaacaagttt
cttggacaccgcatcatccccatcagtgccctgaattctggataccaccatctctgtctg
cacaacgagagcaacatgccgctcaccatgcctgccctctttgtcttcctggagatgaag
gactatgtgcctgacacctgggcagatctcacggtggccctcgccaatcctatcaagttc
ttcagtgcccatgataagaaggctgtgaagctcaaggaagccatgggaggccagctcgag
ggtcccttccctcttgggaatcaccctgccagccaggtcaacggggcatcggctccaaca
agcaatgggtcagcagcagccggggccaaggccagggaggaggccacgaaagaagttgcg
gaaccgcagaccgccagcctggaggagctgcgggagctgaagggcgtcgtgaagctgcag
cggcgccaggagaaggagctgcgggaactggggcggcgcggcgtgcggcgctgggaggag
ctgctgcagaggggcgcggcgcagctggccgggctcgggccgccgggcgcgggagtcagc
ggcgggtgccggggccgcaagctcggcccgggcaagggatcccgcaaaaagaggaccctg
ccaggcgaggacaccgccggggcggcgtcggccgaaggccccgagggcgaggacgtgcgc
cttcgagagctgagggacaggctggagctggagctgctgcagctgggcgaggagcaatgc
gagtgtgtcctgaagctcaaggagcagcacgcggcccagcaaatgaccaagatgatggag
ctggccagggagaaacaggctgcagagcggaagaccctcaaggagaccttggagactgac
accaaagagatgaagaagaagctggaggccaagagactggagcggatccaggccatgatg
aaggtcaccacagacaagatggctcaggagaggttgaagagagagattaacaactcccac
atccaggaggtggtgcaggtgatcaaccagatgaaggagaacctggagaggcaccaggag
aagttggaggagaagcaagcagcctgcctggaacagatccaggagatggaaaaacagttc
cagcaggaggcaatggcagagtacgaggtcaagatgaagggcctggagatggaagtgaag
gaatcagtgaggacctgcctccgggcctgcttcccctctgaggaggaggacaagcctgag
agaccatgtgtggtctccagggagctgtgtgagcaggacatactcacagagcaggcagag
acccaggagagccacctctga

KEGG   Capra hircus (goat): 102180505
Entry
102180505         CDS       T02910                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04621  NOD-like receptor signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
Module
chx_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102180505 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102180505 (PLCB4)
   04310 Wnt signaling pathway
    102180505 (PLCB4)
   04371 Apelin signaling pathway
    102180505 (PLCB4)
   04020 Calcium signaling pathway
    102180505 (PLCB4)
   04070 Phosphatidylinositol signaling system
    102180505 (PLCB4)
   04072 Phospholipase D signaling pathway
    102180505 (PLCB4)
   04071 Sphingolipid signaling pathway
    102180505 (PLCB4)
   04022 cGMP-PKG signaling pathway
    102180505 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102180505 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102180505 (PLCB4)
   04613 Neutrophil extracellular trap formation
    102180505 (PLCB4)
   04621 NOD-like receptor signaling pathway
    102180505 (PLCB4)
   04062 Chemokine signaling pathway
    102180505 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    102180505 (PLCB4)
   04922 Glucagon signaling pathway
    102180505 (PLCB4)
   04929 GnRH secretion
    102180505 (PLCB4)
   04912 GnRH signaling pathway
    102180505 (PLCB4)
   04915 Estrogen signaling pathway
    102180505 (PLCB4)
   04921 Oxytocin signaling pathway
    102180505 (PLCB4)
   04926 Relaxin signaling pathway
    102180505 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    102180505 (PLCB4)
   04918 Thyroid hormone synthesis
    102180505 (PLCB4)
   04919 Thyroid hormone signaling pathway
    102180505 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    102180505 (PLCB4)
   04916 Melanogenesis
    102180505 (PLCB4)
   04924 Renin secretion
    102180505 (PLCB4)
   04925 Aldosterone synthesis and secretion
    102180505 (PLCB4)
   04927 Cortisol synthesis and secretion
    102180505 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102180505 (PLCB4)
   04270 Vascular smooth muscle contraction
    102180505 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    102180505 (PLCB4)
   04971 Gastric acid secretion
    102180505 (PLCB4)
   04972 Pancreatic secretion
    102180505 (PLCB4)
   04973 Carbohydrate digestion and absorption
    102180505 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102180505 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102180505 (PLCB4)
   04725 Cholinergic synapse
    102180505 (PLCB4)
   04728 Dopaminergic synapse
    102180505 (PLCB4)
   04726 Serotonergic synapse
    102180505 (PLCB4)
   04720 Long-term potentiation
    102180505 (PLCB4)
   04730 Long-term depression
    102180505 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    102180505 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    102180505 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    102180505 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102180505 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180505 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102180505 (PLCB4)
   05016 Huntington disease
    102180505 (PLCB4)
   05017 Spinocerebellar ataxia
    102180505 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    102180505 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102180505 (PLCB4)
   04934 Cushing syndrome
    102180505 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102180505 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102180505 (PLCB4)
   05142 Chagas disease
    102180505 (PLCB4)
   05143 African trypanosomiasis
    102180505 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102180505 (PLCB4)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102180505 (PLCB4)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102180505 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102180505 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 102180505
NCBI-ProteinID: XP_013823863
UniProt: A0A452FTU9
LinkDB
Position
13
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGAIPKDPKILAALEALGKSENDLEGRIVCVCSGADLVNISFTYMVAENPE
ITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKQGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSV
MEAGESAAPVNILEDDNEEEIESAEQEEEAHPEYKYGNELSADDLGHKEAIANSVKKASD
DLDHENSKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALGAGLEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKLTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSDMINTHSAEEQEVRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSCV
KLQDTN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaattggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtagatgaatttggcttctttctgacctggagaagtgaaggcaaggaaggccaggtgcta
gaatgttccctcatcaacagtgttcggctgggagccataccaaaggatcccaaaattttg
gctgctcttgaagctcttggcaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtgcagatctggtgaacatcagtttcacgtacatggtggctgaaaatccagaa
ataactaagcaatgggtcgaaggcctgagatccatcattcacaacttcagggccaacaac
gtcagcccgatgacgtgcctcaagaagcactggatgaaattggcatttatgaccaacaca
aatgggaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagctaggtcttcccagtggaaagaatgatgaaattgag
cctgccgcatttacttacgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaggatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgactgaatgaaattttattc
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcctgatgaagat
ttgaagaaacaaggcctcatatcaagtgatgggttttgcagatacctgatgtcagatgaa
aatgcccccgtcttcctagatcgtctagagctgtaccaagaaatggaccaccctctggct
cactacttcatcagctcttcccacaacacctatctcactggcagacagtttggtgggaaa
tcttcagtagaaatgtacagacaggtcctcctggctggttgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaggaccaagaaccgataataactcatggaaaagcgatgtgc
acagatatccttttcaaggatgttattcaagccatcaaggaaactgcctttgtcacgtcg
gaataccctgtgattctctcctttgaaaaccactgcagcaaatatcaacagtacaagatg
tccaaatattgtgaagatctatttggagatctcctgttgaaacaagcacttgaatcacat
ccactggaaccaggcagacccttgccatccccgaatgacctcaaaagaaaaatactcatc
aaaaacaaacgactgaaacctgaggttgaaaaaaaacagcttgaagctttgaaaagtgtg
atggaagcaggagaatccgctgccccagtgaacatcctagaggatgacaatgaagaggaa
atagaaagtgctgagcaagaggaggaagctcaccctgaatacaaatatggaaatgaactt
tctgcagatgacttgggtcacaaggaagctattgccaatagtgtcaagaaggcttcagat
gaccttgaccatgaaaacagcaaaaagggcctggttaccgtagaagatgagcaggcgtgg
atggcgtcttacaaatatgtgggtgctaccactaatatccatccgtatttgtccacaatg
atcaactacgcacagcctgtaaagtttcaaggtttccatgtggctgaagaacgcaatatt
cattacaacatgtcttcttttaatgagtcagtcggtctaggctacttgaagacacacgcc
atagagtttgtgaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtggactccagtaattacatgcctcagattttctggaacgctggctgccagatggtttcg
ctgaactatcaaaccccagatttagcgatgcaattgaatcaggggaaatttgagtataat
ggatcctgcgggtaccttctcaagccagatttcatgagacggcccgatcgaacattcgac
cctttctctgaaacgcctgttgacggggttattgcagccacttgctccgtgcaggtcata
tcaggtcagttcttatcagataagaaaattggcacatatgtagaagtggacatgtatggg
ctgcccacggacactatccgaaaggagttccgcactcgcatggtgatgaacaacggtctc
aatcccgtttacaatgaagagtcatttgtgtttcggaaggtgatcctccccgacctggct
gtcttgaggatcgccgtgtatgatgacaacaacaagctgatcggccagaggattctgcct
ctggacggcctccaagcaggctatcgacacatatccctccggaatgagggaaataaacct
ttatcgctgccaaccattttctgcaacattgtcctaaaaacatatgtgcctgatggattc
ggagatattgtggatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcggatcaaatgagagctatgggcattgaaactagtgacatcgccgatgtgcccagtgac
acttcaaagaacgacaagaaagggaaagccaacacagccaaagcgaatgtgacccctcag
agcagctcggagctcaggccaaccaccacagctgccctgggggctggcctggaggccaag
aaaggtattgaactgatccctcaagtgaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacaacagaaagagctcaattctttaaagaagaaacatgcaaag
gaacacagtaccatgcagaaactacattgcacgcaagttgacaagattgtggcacagtac
gacaaggagaaattgactcatgagaaaatcctcgagaaggcaatgaagaagaaaggggga
agtaactgtcttgaaatgaagaaagaaacagaaattaaaattcagacgctgacatcagat
cacaaatctaaggtcaaggagattgtggcacagcacacaaaggagtggtcagacatgatc
aacacccacagtgcggaggagcaggaggtccgggacctgcacctcagccagcagtgcgaa
ctgctcagaaagctgctgatcagcgcccacgagcagcagacccagcagctgaaactgtcc
catgacagggaaagcaaagagatgcgagcccaccaagctaagatttctatggaaaatagc
aaagccatcagccaagataaatccatcaagaataaagcagaacgggaaaggagagtcagg
gagttaaatagcagcaacactaaaaagtttctggaagaaagaaagagactcgccatgaag
cagtccaaagaaatggatcagttgaaaaaagtccagctggagcacctcgaattcctagag
aaacagaatgagcagcttttgaaatcctgtcatgcagtgtcccaaactcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagttgtgtg
aaactccaggacacaaactga

KEGG   Capra hircus (goat): 102188148
Entry
102188148         CDS       T02910                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04621  NOD-like receptor signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
Module
chx_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102188148 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102188148 (PLCB1)
   04310 Wnt signaling pathway
    102188148 (PLCB1)
   04371 Apelin signaling pathway
    102188148 (PLCB1)
   04020 Calcium signaling pathway
    102188148 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102188148 (PLCB1)
   04072 Phospholipase D signaling pathway
    102188148 (PLCB1)
   04071 Sphingolipid signaling pathway
    102188148 (PLCB1)
   04022 cGMP-PKG signaling pathway
    102188148 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102188148 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188148 (PLCB1)
   04613 Neutrophil extracellular trap formation
    102188148 (PLCB1)
   04621 NOD-like receptor signaling pathway
    102188148 (PLCB1)
   04062 Chemokine signaling pathway
    102188148 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    102188148 (PLCB1)
   04922 Glucagon signaling pathway
    102188148 (PLCB1)
   04929 GnRH secretion
    102188148 (PLCB1)
   04912 GnRH signaling pathway
    102188148 (PLCB1)
   04915 Estrogen signaling pathway
    102188148 (PLCB1)
   04921 Oxytocin signaling pathway
    102188148 (PLCB1)
   04926 Relaxin signaling pathway
    102188148 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    102188148 (PLCB1)
   04918 Thyroid hormone synthesis
    102188148 (PLCB1)
   04919 Thyroid hormone signaling pathway
    102188148 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102188148 (PLCB1)
   04916 Melanogenesis
    102188148 (PLCB1)
   04924 Renin secretion
    102188148 (PLCB1)
   04925 Aldosterone synthesis and secretion
    102188148 (PLCB1)
   04927 Cortisol synthesis and secretion
    102188148 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102188148 (PLCB1)
   04270 Vascular smooth muscle contraction
    102188148 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    102188148 (PLCB1)
   04971 Gastric acid secretion
    102188148 (PLCB1)
   04972 Pancreatic secretion
    102188148 (PLCB1)
   04973 Carbohydrate digestion and absorption
    102188148 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102188148 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102188148 (PLCB1)
   04725 Cholinergic synapse
    102188148 (PLCB1)
   04728 Dopaminergic synapse
    102188148 (PLCB1)
   04726 Serotonergic synapse
    102188148 (PLCB1)
   04720 Long-term potentiation
    102188148 (PLCB1)
   04730 Long-term depression
    102188148 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    102188148 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    102188148 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    102188148 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102188148 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188148 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102188148 (PLCB1)
   05016 Huntington disease
    102188148 (PLCB1)
   05017 Spinocerebellar ataxia
    102188148 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102188148 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188148 (PLCB1)
   04934 Cushing syndrome
    102188148 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102188148 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102188148 (PLCB1)
   05142 Chagas disease
    102188148 (PLCB1)
   05143 African trypanosomiasis
    102188148 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102188148 (PLCB1)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102188148 (PLCB1)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102188148 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102188148 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 102188148
NCBI-ProteinID: XP_017912397
LinkDB
Position
13
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWEDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLDKYPLESGVPLPSPMDLMYKILVKNKKKSHKSAEGGGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTSQG
NAVNPIWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGEAPSEAPSEARPTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDNKKKSEPSSPDHVSSTIEQDLAALDAEMTQKLVDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPLMTSDSGKLNQKLPSS
EELEGENPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggcacagcctggagtgcacgcgctgcaactcaagccggtgtgcgtgtcggac
agcctcaagaagggcaccaaattcgtcaagtgggaggatgactccactattgtcactccg
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggaactgttagatctcagccttgtcaaagacgccagatgtgggaagcatgccaaggcg
cccaaggaccctaaattacgtgaacttctggatgtggggaacattgggcgcctggaacat
cgcatgataacagtagtgtatgggcctgacttagtgaacatctcccacttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggacgcatttctggaaaaggcgtatactaaacttaag
ctgcaagtcactccagaaggacgcattcctctgaaaaacatataccgcctgttctcagca
gaccggaagcgagtcgagacagctttagaggcttgtagtcttccatcttcaaggaatgat
tcgatacctcaagaagatttcactcctgaagtgtacagagttttcctgaacaacctttgt
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatacctt
acagttgatcagatgatggattttatcaacctcaagcagcgagatccccggctaaatgaa
atactttacccacctttaaagcaagagcaagtccaagtgttgattgagaagtatgaacct
aacaacagcctcgccaaaaaaggacagatatcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagatatgtctcag
cccctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcctctgtcgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggagccagtcatcacccatgggttc
accatgaccacagaaatatccttcaaggaagtgatcgaagccattgctgagtgtgcattt
aagacttcaccttttccaattctgctttcatttgagaaccatgtggactcgccgaagcag
caggccaagatggcggagtactgcagactcatcttcggcgacgccctcctcatggagccg
ctggacaagtacccgttggaatctggagttccccttccaagtcctatggatttgatgtac
aaaattttggtgaaaaataagaagaaatcacacaagtcagcagaaggaggtggcaagaag
aagctctcagaacaagcttccaacacgtacagcgactcctccagtgtgtttgagccctcg
tccccaggagccggagaagctgatacagagagtgacgatgatgacgatgatgatgactgt
aaaaagtcttccatggatgaggggaccgcagggagcgaggccatggctacagaagagatg
tctaatctggtgaactatatccagccagtcaagttcgagtcatttgaaatttcaaaaaaa
agaaatagaagcttcgagatgtcttcctttgtggaaaccaaaggtcttgagcaacttaca
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaag
ggaacacgcgtggattcatctaactatatgcctcagcttttctggaatgcaggctgccaa
atggttgcccttaatttccaaacagtggacctggctatgcagataaacatggggatgtat
gaatacaatgggaagagtggctacaggctgaagccggagttcatgaggagacctgacaag
cactttgatccattcacagaaggcatcgtggatggcatagtggccaacactttatctgtt
aagattatttcaggtcagtttctctctgataagaaagtcgggacttacgtggaagtggat
atgtttggtttgcctgtggacacaaggaggaaggcattgaagaccaaaacatcacaagga
aacgctgtaaatcccatctgggaagaagaacccattgtattcaaaaaggtggttcttcct
tcgctagcctgtctgaggatagcagtttatgaagaaggaggtaaatttattggtcaccga
atcttgccagtacaagcaattcggccaggctatcactacatctgtctgaggaacgagagg
aaccagcctctgatgctgccagccctctttgtctacatagaggtgaaggactatgtccca
gacacatatgcagacgtgattgaagctttgtcaaatccaatccgatatgtgaatctgatg
gagcagagagctaaacaactggctgctttgaccctggaagatgaagaagaagtgaagaaa
gaggctgatcctggggaagcaccatcagaagctccgagtgaagccaggccaactccagca
gaaaacggggtgaatcacacgacgtccctgacacccaaaccaccctcccaggctctgcac
agccaaccggctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gttttaacagaagtagaagcgcagacgattgaagagctaaagcagcagaagtcgtttgtg
aaacttcaaaagaagcactacaaggaaatgaaagacctggttaagagacaccacaagaaa
accaccgacctcatcaaagagcacactacaaaatacaatgaaatccagaacgactacttg
agaaggagagcagctctggaaaagacagccaaaaaggacaataagaaaaaatcagaaccc
agtagccctgaccacgtctcatcaacaattgaacaagaccttgctgccctggatgccgaa
atgacccaaaagttagtagatctgaaggacaaacagcagcagcagctgcttaatcttcga
caagagcagtattatagcgaaaaataccagaagcgagaacacattaaactgcttattcaa
aaattgactgatgttgctgaagaatgtcagaataatcagttaaagaagctcaaagaaatc
tgtgagaaagagaagaaggaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaggaggaaaagacggagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaactcgtggagaaacacaaagaaatccgccagcagatcctggatgaaaagccc
aagctacaggtggaactggagcaagaataccaagacaagttcaaaaggctgcccctggag
attttggaattcgtgcaggaagccatgaaagggaagattagtgaagacagcaatcacagc
tctgcccctcccctgatgacctcagactctggaaaactaaaccagaagcttccttccagt
gaagaattggaaggagaaaacccaggaaaagagtttgatacccctctgtga

KEGG   Capra hircus (goat): 102189653
Entry
102189653         CDS       T02910                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04613  Neutrophil extracellular trap formation
chx04621  NOD-like receptor signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
Module
chx_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102189653 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102189653 (PLCB3)
   04310 Wnt signaling pathway
    102189653 (PLCB3)
   04371 Apelin signaling pathway
    102189653 (PLCB3)
   04020 Calcium signaling pathway
    102189653 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102189653 (PLCB3)
   04072 Phospholipase D signaling pathway
    102189653 (PLCB3)
   04071 Sphingolipid signaling pathway
    102189653 (PLCB3)
   04022 cGMP-PKG signaling pathway
    102189653 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102189653 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102189653 (PLCB3)
   04613 Neutrophil extracellular trap formation
    102189653 (PLCB3)
   04621 NOD-like receptor signaling pathway
    102189653 (PLCB3)
   04062 Chemokine signaling pathway
    102189653 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    102189653 (PLCB3)
   04922 Glucagon signaling pathway
    102189653 (PLCB3)
   04929 GnRH secretion
    102189653 (PLCB3)
   04912 GnRH signaling pathway
    102189653 (PLCB3)
   04915 Estrogen signaling pathway
    102189653 (PLCB3)
   04921 Oxytocin signaling pathway
    102189653 (PLCB3)
   04926 Relaxin signaling pathway
    102189653 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    102189653 (PLCB3)
   04918 Thyroid hormone synthesis
    102189653 (PLCB3)
   04919 Thyroid hormone signaling pathway
    102189653 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102189653 (PLCB3)
   04916 Melanogenesis
    102189653 (PLCB3)
   04924 Renin secretion
    102189653 (PLCB3)
   04925 Aldosterone synthesis and secretion
    102189653 (PLCB3)
   04927 Cortisol synthesis and secretion
    102189653 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102189653 (PLCB3)
   04270 Vascular smooth muscle contraction
    102189653 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    102189653 (PLCB3)
   04971 Gastric acid secretion
    102189653 (PLCB3)
   04972 Pancreatic secretion
    102189653 (PLCB3)
   04973 Carbohydrate digestion and absorption
    102189653 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102189653 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102189653 (PLCB3)
   04725 Cholinergic synapse
    102189653 (PLCB3)
   04728 Dopaminergic synapse
    102189653 (PLCB3)
   04726 Serotonergic synapse
    102189653 (PLCB3)
   04720 Long-term potentiation
    102189653 (PLCB3)
   04730 Long-term depression
    102189653 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    102189653 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    102189653 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    102189653 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102189653 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102189653 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102189653 (PLCB3)
   05016 Huntington disease
    102189653 (PLCB3)
   05017 Spinocerebellar ataxia
    102189653 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    102189653 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102189653 (PLCB3)
   04934 Cushing syndrome
    102189653 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102189653 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102189653 (PLCB3)
   05142 Chagas disease
    102189653 (PLCB3)
   05143 African trypanosomiasis
    102189653 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102189653 (PLCB3)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102189653 (PLCB3)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102189653 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102189653 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 BPL_N
Other DBs
NCBI-GeneID: 102189653
NCBI-ProteinID: XP_017898278
UniProt: A0A452FAC8
LinkDB
Position
29
AA seq 1234 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRLGSGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEAGLEKPSLEPRKSLGE
EGLQRGPDALGPAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAHSGPETSQETQTQQL
GYQLNPHPTPSPLDASPRRPPGPATSPTSSSISSSISSPGQRDDLIASILSEVAPAPLDE
LRGHKALVKLRSRQERDFRELYKKHQRKAVALTRRLLDNLAQARAGSRCRQRPGVLSGED
ERAEDEEVSRYQEFQKKQVQCLLELREAQVDTEAERRLEHLQQAQLKLREVVLDAHMTQL
KKLKEINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRQERLVAGQQQVLQQLAEEEPKLLAQLVQECQEQRERLPQEIRWSLLGETPEGLG
DGHLVACASNGHAPGSSGHLPGADSESQEETTKL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtcgtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtaaccctgcgtgtggactccaatggcttcttcctgtactggacaggacccaacatggag
gtggacacactcgacatcagttccatcagggacaccaggacgggccgttatgcccgcctg
cccaaggaccccaagatccgggaggtgttgggcttcgggggccctgatgcccggttggag
gagaagctgatgacagtggtggctgggccagacccggtgaatacaacattcttgaacttc
atggccgtgcaggacgatacagccaaggtctggtccgaggagctcttcaagttggctatg
aacatcctggctcagaacgcctcccggaacaccttcttgcgcaaagcatacacgaagctg
aagctgcaggtaaaccaggatggacggattccagtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtagaaactgcactggaatcctgtggcctcaatttcaaccgaagc
gagtccatccggcctgacgagttttccttggaaatcttcgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaaaccttac
ctgacactggagcagctcatggatttcatcaaccagaagcagcgggacccgcggctcaac
gaagtgctgtacccgcctctgcggccctcccaggcccggctgctcatcgagaagtatgag
cccaacaagcagttcctggagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaggagaacggcattctgccgcttgaggccttggatctgagcgcagacatgacc
cagccgctcagtgcctacttcatcaattcctcacataacacctatctcacggcgggacag
ctggccggaacctcgtcggtggagatgtaccggcaggcgctgttgtggggctgccgctgc
gtggagctggacgtgtggaaggggcggccgcccgaggaggagccgttcatcacacacggt
ttcaccatgaccacggaggtgccgctgagagacgtgctcgaggccatcgcggagaccgcc
ttcaagacctcgccctaccccgtcatcctctcctttgagaaccacgtggactcggcgaaa
cagcaggccaagatggccgagtactgccgctccatctttggggatgctctgctcatcgac
cccctggacaagtacccgctggccccgggcgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccggctcggcagcggcgtccctgacagc
tccgtgcgcaagcggccgctggagcagagcaactcggccctgagcgagagctctgccgcc
accgagccctcctcgccccagcttgggtcccccagctctgacagctgcccaggcctgagc
aatggggaggaggcgggcctcgagaagcccagcctggagcctcggaagtctctgggggag
gagggtttgcagcggggccctgatgctcttggacctgcctaccgggaggatgaggaggag
gacgaggaagaggaggaacagacggaccccaaaaagccgaccacagatgagggcaccgcc
agcagtgaggtcaacgccactgaggaaatgtccacgcttgtcaactacattgagcctgtc
aagttcaagtccttcgaggctgctcgaaagaggaacaagtgcttcgagatgtcatccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgtgtggactcatccaactacatg
ccccagctcttctggaacgtgggctgccagctcgttgcactcaacttccagaccctggat
gtgccgatgcagctcaatgccggcgtgtttgagtacaacgggcgcagtggctacctactc
aagcctgagttcatgcggcggccggacaagtcctttgaccccttcaccgaagtcatcgtg
gacggcatcgtggccaatgccgtgcgggtcaaggtgatctcggggcagttcctgtctgac
aggaaggtgggcatctacgtggaggtggatatgttcgggctccccgttgacacacggcgc
aagtaccgcacgcggacctcacaggggaactcgttcaaccccgtgtgggatgaggagcca
ttcgacttccccaaggtggtgctgcccacgctggcttcgctgcgcatcgcggcctttgag
gaggggggcaagttcgtagggcaccggatcctgcctgtctccgccatccgctcagggtac
cattacatctgcctgcggaacgaggccaaccagccactgtgcctgccagccctgctcatc
tacaccgaggcctccgactacatccctgatgaccaccaggactatgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagcgaggctcattctggcccggagacaagccaggagacccagactcagcagctg
gggtaccaactgaacccacaccccacacccagcccactggatgcctccccacgccggccc
ccaggccccgccacctccccgaccagctcctccatcagctcctccatcagcagcccaggt
cagcgtgatgatctcattgccagcatcctctcagaggtggccccggccccgctggatgag
ctccgaggccacaaggccctggtgaagctccggagccggcaagagcgagacttccgggag
ctgtacaagaaacatcagcggaaggctgttgccctcacgcgccggttgctcgacaacctg
gcccaggcccgcgcggggagcaggtgccgacagcggcccggtgtcctaagcggggaggac
gagagggcagaagatgaagaggttagcaggtatcaagagttccagaagaaacaggtgcag
tgtctgctggagctgagggaggcccaggtggacacggaggcggagcggaggctggagcat
ctgcagcaggctcagctgaagctcagggaggttgtcctggacgctcacatgactcagttg
aagaaactgaaggagataaatgagagggagaagaaggaactgcagaagatcctggacagg
aaacgccacaacagtatctcagaggccaagaccagggagaaacacaagaaggaggcggaa
ctgacagaaattaaccggcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcaggaacgccttgtggccgggcagcagcaggtcctccaacag
ctggcggaagaggagcccaagctgctggcccagctggtccaggagtgtcaggagcagcgg
gagaggctgccccaggagatccgctggagcctgctgggcgagacaccggagggactgggg
gacgggcatctggtcgcctgtgccagcaacggtcacgcgcctgggagcagcgggcacctg
cctggcgctgactcagagagccaggaggagactacaaagctctga

DBGET integrated database retrieval system