KEGG   Capra hircus (goat): 102169982
Entry
102169982         CDS       T02910                                 

Gene name
ISG15, ISG17/UCRP
Definition
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
chx05165  Human papillomavirus infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102169982 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102169982 (ISG15)
   05169 Epstein-Barr virus infection
    102169982 (ISG15)
   05165 Human papillomavirus infection
    102169982 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102169982 (ISG15)
Ubiquitin system [BR:chx04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   102169982 (ISG15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_5 TUG-UBL1 Lac_bphage_repr
Other DBs
NCBI-GeneID: 102169982
NCBI-ProteinID: XP_005690852
UniProt: F2X355
LinkDB
Position
16
AA seq 157 aa
MGGDLKVKMLGGEEILVPLRDSMMVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPL
VHQGLKAGSTILLMVQNCSATLNILVRNDKGRSSSYEVQLTQTVAVLKQQVCQKERVQAD
QFWLSFEGKPMDDEHPLGEYGLTTGCTVFMNLRLRGG
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggcggggacctgaaggtgaagatgctagggggcgaggagatcctggtgcctctgagg
gactccatgatggtatctgagctgaagcagttcatcgcccagaagatcaatgtgcctgct
ttccagcagcgcctggcccaccttgacagcagggaagtgctgcaggaaggggtgcccctt
gtccaccagggcctgaaagctggcagcaccatcctgctgatggtgcagaactgcagcgcc
accctgaacatcctggtgaggaacgacaagggtcgcagcagctcctatgaggtccagctg
acgcagactgtggctgtgctcaagcagcaggtgtgccaaaaggagcgtgtgcaagcggac
caattctggctgtcttttgaagggaagcccatggatgatgagcacccactgggggaatac
ggcctcacgaccgggtgcaccgtgttcatgaatctacgtctgcggggtgggtag

DBGET integrated database retrieval system