KEGG   Capra hircus (goat): 102170124
Entry
102170124         CDS       T02910                                 

Gene name
CD4
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04514  Cell adhesion molecules
chx04612  Antigen processing and presentation
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx05135  Yersinia infection
chx05166  Human T-cell leukemia virus 1 infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102170124 (CD4)
   04514 Cell adhesion molecules
    102170124 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102170124 (CD4)
   04612 Antigen processing and presentation
    102170124 (CD4)
   04660 T cell receptor signaling pathway
    102170124 (CD4)
   04658 Th1 and Th2 cell differentiation
    102170124 (CD4)
   04659 Th17 cell differentiation
    102170124 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102170124 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    102170124 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102170124 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102170124 (CD4)
   05170 Human immunodeficiency virus 1 infection
    102170124 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    102170124 (CD4)
CD molecules [BR:chx04090]
 Proteins
  102170124 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig Ig_3 V-set I-set Ig_2 Tcell_CD4_C Ig_6 Receptor_2B4 Ig_5 Ig_4 Herpes_gE P_proprotein DUF3277
Other DBs
NCBI-GeneID: 102170124
NCBI-ProteinID: XP_005680997
UniProt: A0A452E3R1
LinkDB
Position
5
AA seq 455 aa
MGPGTSLRHLFLVLQLVMLPAGTQGKAVVLGKAGGQAELPCQASQKKNIVFSWKDSSQSK
ILGSHNSFLHKGNTELSRRVESKRNLWDQGSFPLIIKNLQVTDSGTYTCEVDSKKLEVEL
KVFGLTASSDTRLLLGQSLTLTLESPSGSNPSVQWKGPGNNRKEELKSLSLAQVGLQDSG
TWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEDENLSGELTWQQ
ANKDSSSQSWVTFTLRNREVKVNKTHKDLKLRVEERLPLRLTLLRTLPQYAGSGTLTLDL
SKGKLHQKVNLVVMRVTKSPNSLTCEVLGPSPPRLTLNLKLGNQSMKSSNQPKLVTEPEP
KAGMWQCLLSDQGKVLLESKIEVLPSEFIQAWPMLLPMVLGGIAGLALLTGSCIFCVKCW
HRRRQAERMSQIKRLLSEKKTCQCPHRLQKTHSLT
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggcccggggacctctcttaggcacctgttcttggtgctgcaactggtgatgctcccg
gctggcactcagggaaaagcagtggtgctgggtaaggcaggaggccaggcagagctgccc
tgccaggcttcccagaagaagaacatagtcttcagctggaaagattcttcccagtccaag
attctggggagtcataactccttcttgcacaaaggtaacactgaactgagccgtcgagtg
gaatccaaaagaaacctgtgggaccaaggatcctttcctctgatcatcaagaacctccaa
gtaactgactcggggacttatacctgtgaagtggatagcaagaagctcgaggtggaactg
aaggtgttcggactgactgccagctcggacacccgtctactgctgggacagagcctgacc
ttgactttggagagtccctctgggagcaacccttctgtgcagtggaagggtccagggaat
aataggaaggaagaactcaagagcctgtcactggcccaggtggggctgcaggacagtggt
acctggacgtgcactatctcccagagccagcagacactggagatcaaaatacccatcgtg
gtgctggccttccagaaggcccccgaaacagtctatgtgaaggagggggagcaggcggag
ttttccttcccactcaccttcgaggatgaaaatctgagtggggagctgacttggcagcag
gcgaacaaggattcttcctcccaatcctgggtcaccttcaccctgaggaacagagaggtg
aaggtgaacaagactcacaaggacctcaagctccgtgtggaggagaggctaccgctgcgt
ctcactctgctgcggaccttgcctcagtacgcgggttctggaaccctgaccctggatctc
tccaaggggaagctgcatcagaaagtgaacctcgtggtgatgagagtgactaagtcccca
aacagtctgacctgtgaggtgctggggcccagccccccaaggctgaccctgaacttgaag
ctggggaaccagagtatgaagagctcaaatcagccaaagttggtgacagagccggaaccc
aaggctgggatgtggcagtgtctgctgagtgaccagggcaaagtcctgctggaatccaag
atcgaggtcttgccgtcagagttcatccaggcctggccgatgctcctgcccatggtgttg
gggggaatcgcaggcctagcgcttctcactggctcctgcatcttctgtgttaaatgctgg
caccgcaggcgccaggcagaacggatgtctcaaatcaagaggctcctcagtgagaagaag
acctgccagtgcccccaccgtctccagaagacccacagtctcacctga

DBGET integrated database retrieval system