KEGG   Capra hircus (goat): 102170129
Entry
102170129         CDS       T02910                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04510  Focal adhesion
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04921  Oxytocin signaling pathway
chx05140  Leishmaniasis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05213  Endometrial cancer
chx05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102170129 (ELK1)
   04012 ErbB signaling pathway
    102170129 (ELK1)
   04014 Ras signaling pathway
    102170129 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102170129 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102170129 (ELK1)
   04912 GnRH signaling pathway
    102170129 (ELK1)
   04921 Oxytocin signaling pathway
    102170129 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102170129 (ELK1)
   05205 Proteoglycans in cancer
    102170129 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102170129 (ELK1)
   05213 Endometrial cancer
    102170129 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102170129 (ELK1)
   05161 Hepatitis B
    102170129 (ELK1)
   05163 Human cytomegalovirus infection
    102170129 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102170129 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102170129 (ELK1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102170129 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 102170129
NCBI-ProteinID: XP_017899237
UniProt: A0A452E2D2
LinkDB
Position
X
AA seq 440 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTLANAGATAVH
AIPGDTASGKPGTLKGAGMAGPGGLARSSRNDYMRSGLYSTFTIQSLQPQPPSHPRPSTV
LPNTGPAGVAVPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNLKSEEPNMEPGL
GRPLPPEVKVEEPKEELEAAASGEAGFVLEAVKAEPFEPKVDPEVPPAEGVPARLSAVVM
ETAAQVGGLTASTTPSAEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAP
GPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIP
SISVDGLSTPVVLSPGPQKP
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggacccttctgtgacgctgtggcagtttctgctgcagctgctaagagagcaaggcaat
ggccacatcatctcctggacctcacgggatggcggtgagttcaagctggtggacgctgag
gaggtggcccggctgtgggggctgcgcaagaataagaccaacatgaactatgacaagctc
agccgggctttgcggtactattatgacaagaatatcatccgcaaagtgagcggccagaag
tttgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
cctcagcctgaggtgtctgtcacctccactctggcaaatgcaggcgccacagctgtacac
gccatccccggggacactgcctctgggaagccaggcacactcaagggtgcaggaatggca
ggcccaggcggcttggcgcgcagcagccgaaatgattacatgcgctcaggcctctattcc
accttcaccatccagtccctgcagccacaaccgccctctcaccctcgaccttccacagtg
ctccccaacaccggccctgcaggagtagcagtgcctccctcggggagcaggagcaccagt
ccaaaccccttggaggcctgcctggaagctgaggaggctggcctgcctctgcaggtcatc
ctgaccccacccgaggccccaaaccttaaatccgaagagccaaatatggagcctgggttg
ggccggccactgcccccagaagtcaaagtggaagagcccaaggaagagttagaagctgca
gccagtggggaggcggggtttgtgctggaagccgtcaaggccgagccctttgagcccaaa
gtcgacccagaagtccctccagcagagggcgtgccagcccggctgtccgctgtcgtaatg
gaaactgcggcgcaggtgggcggcctcacggcttccacaacacccagcgcggagattgcc
cagcctcagaagggccggaagccccgggacctggagcttccactcagcccgagcctgctg
ggtggaccaggacccgaacggactccgggatcgggaactggttcaggtctacaggcgcca
ggtccagcgctgacgccttccctgctacctacgcacacattgaccccggtgctgctgacg
cccagctcgctgccccccagcattcacttctggagcaccctgagtcccattgcgccccgt
agcccggccaagctctccttccagtttccgtccagtggcagcgcgcaggtgcacatccct
tccatcagcgtggatggcctctcaacccccgtggtgctctccccagggccccagaagcca
tga

DBGET integrated database retrieval system