KEGG   Capra hircus (goat): 102170328Help
Entry
102170328         CDS       T02910                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00590  Arachidonic acid metabolism
chx01100  Metabolic pathways
chx04611  Platelet activation
chx04726  Serotonergic synapse
chx04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102170328 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102170328 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102170328 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    102170328 (PTGS1)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102170328 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102170328
NCBI-ProteinID: XP_005687101
LinkDB All DBs
Position
11
AA seq 600 aa AA seqDB search
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLRLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtatctcgctccgattcccgctgcttctcctgctgctgtcgccatcc
cccgtcttctcagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgtacc
cgcacgggctattccggccccaactgcaccatccctgagatatggacctggctccggacg
actttgcggcccagcccctctttcatccactttctgctgacgcacgggcgctggctttgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcacgattacatcagctgggag
tccttctccaatgtgagttattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatgggcaccaaagggaagaagcaattgccagatgcggagttcctgagccgtcgc
ttcctgctcaggaggaagttcatccccgaccctcaaggcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttctttaaaacttccggcaagatgggtcctggcttc
accaaggcgctgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaagctcaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggcgcctgtgctgatgcactacccccggggcatcccg
ccccagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctc
tacgccacgatctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
cccacctggggcgacgagcagctcttccagacagcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtacgtgcagcagctgagcggctacttcctgcggctcaag
ttcgacccagagctgctgttcggggcccagttccagtaccgcaaccgcatcgccatggag
ttcaaccagctgtaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcgggccggattggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcgcgggagctgaggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ctcacaggtgagaaggagatggcagctgagttggaggagctgtatggagacatcgatgct
ttggaattctacccggggctacttcttgagaagtgccatcctaactccatctttggggag
agtatgatagaaatgggggctcctttctcccttaagggcctcttaggaaaccccatctgt
tctccagagtactggaaggcgagcacatttggtggtgaggtgggcttcaaccttgtcaag
acggccacgctaaagaagctggtttgcctcaacaccaagacttgtccctatgtttccttc
cacgtgccagacccccgtcaggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system