KEGG   Capra hircus (goat): 102170543Help
Entry
102170543         CDS       T02910                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chx  Capra hircus (goat)
Pathway
chx00010  Glycolysis / Gluconeogenesis
chx00053  Ascorbate and aldarate metabolism
chx00071  Fatty acid degradation
chx00280  Valine, leucine and isoleucine degradation
chx00310  Lysine degradation
chx00330  Arginine and proline metabolism
chx00340  Histidine metabolism
chx00380  Tryptophan metabolism
chx00410  beta-Alanine metabolism
chx00561  Glycerolipid metabolism
chx00620  Pyruvate metabolism
chx01100  Metabolic pathways
Module
chx_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102170543 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102170543 (ALDH2)
   00620 Pyruvate metabolism
    102170543 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102170543 (ALDH2)
   00561 Glycerolipid metabolism
    102170543 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102170543 (ALDH2)
   00310 Lysine degradation
    102170543 (ALDH2)
   00330 Arginine and proline metabolism
    102170543 (ALDH2)
   00340 Histidine metabolism
    102170543 (ALDH2)
   00380 Tryptophan metabolism
    102170543 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102170543 (ALDH2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102170543 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102170543
NCBI-ProteinID: XP_005691616
LinkDB All DBs
Position
17
AA seq 520 aa AA seqDB search
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVFYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgttgcgcttgccgcggcccgcctcggaccccgccagggccgccgcctg
ctgtccgccgccacccaggccgtgccgacccccaaccagcagcctgaggtcttctacaac
cagatctttataaacaatgagtggcatgatgccgttagcaagaaaaccttccccacggtc
aatccatccactggggacgtcatctgtcacgtggctgaaggggacaaggcagacgtggac
agggcagtgaaggcagcccgggccgcattccagctgggctcgccctggcgccgcatggac
gcgtccgagaggggccggctactgaaccgcctggctgatctgattgagcgagaccggacc
tacctggcagccttggagaccctggacaatggcaagccctatgtcatctcctacctggtg
gatttggacatggtcctcaagtgcctgcgttactatgctggctgggctgacaagtaccac
gggaaaaccattcccatcgacggggactacttcagctacacccgccatgaacctgtggga
gtgtgtgggcagatcatcccatggaacttcccgctcttgatgcaagcctggaaactgggc
ccagccttggcgacgggaaacgtggttgtgatgaaggtggctgagcagactccactcact
gccctctatgtggccaacctgattaaggaggctggctttcctccgggtgtggtcaatatt
attcctggatttggccccacggccggagctgccatcgcctcccatgaggacgtggacaaa
gtggcattcaccggctccaccgaggttggccacctaatccaggttgctgcggggaagagt
aatctgaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagat
gctgatatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccag
tgctgctgtgcaggctcgcggacctttgtgcaggaggacatttacgccgagtttgtggaa
cggagtgttgcccgggccaagtctcgtgtggttgggaacccctttgacagccggactgag
caggggccgcaggtggatgaaacgcagtttaagaaggtccttggctatatcaaatctggg
aaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttc
atccagcccaccgtgtttggagatgtgcaagatggcatgaccatcgcaaaggaggagatc
tttgggccagtgatgcagattctgaagttcaagagcatggaggaagtcgttgggagagcc
aacaattccaagtacgggctggctgcagctgtcttcacgaaggacttggacaaggccaat
tacctgtcccaggccctccaggccggcactgtgtgggtcaactgctatgacgtgtttggg
gcccagtcgccattcggtggctacaagctgtctgggagtggccgggagctgggggaatat
gggctgcaggcatacaccgaagtgaagaccgtcacggtcagagttcctcagaagaactcc
taa

DBGET integrated database retrieval system