KEGG   Capra hircus (goat): 102170760
Entry
102170760         CDS       T02910                                 

Gene name
FADD
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04668  TNF signaling pathway
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05142  Chagas disease
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102170760 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102170760 (FADD)
   04215 Apoptosis - multiple species
    102170760 (FADD)
   04217 Necroptosis
    102170760 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102170760 (FADD)
   04621 NOD-like receptor signaling pathway
    102170760 (FADD)
   04622 RIG-I-like receptor signaling pathway
    102170760 (FADD)
   04657 IL-17 signaling pathway
    102170760 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102170760 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102170760 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    102170760 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102170760 (FADD)
   05152 Tuberculosis
    102170760 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102170760 (FADD)
   05161 Hepatitis B
    102170760 (FADD)
   05160 Hepatitis C
    102170760 (FADD)
   05164 Influenza A
    102170760 (FADD)
   05162 Measles
    102170760 (FADD)
   05168 Herpes simplex virus 1 infection
    102170760 (FADD)
   05163 Human cytomegalovirus infection
    102170760 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102170760 (FADD)
   05169 Epstein-Barr virus infection
    102170760 (FADD)
   05165 Human papillomavirus infection
    102170760 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102170760 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102170760 (FADD)
SSDB
Motif
Pfam: Death DED HTH_25 tRNA_NucTran2_2 DUF3176
Other DBs
NCBI-GeneID: 102170760
NCBI-ProteinID: XP_017898637
UniProt: A0A452DW12
LinkDB
Position
29
AA seq 209 aa
MDPFLVLLHSVSVGLSSSDLTQLKFLCRNRVSKRKLELAQSGLDLFTVLLEQNELSAERT
VLLRELLGSLRRKDLLCLLDDFERGAEAGAAPEERDLRAAMEIICDNVGKDWKRLARRLR
VSETKIEAIEEKYPRNLVEQVRELLRVWKNSAREDAAVSCLVSALRGCQLNVVADLIEED
QWAQARQRRSTSPGSLMAWDSGSAAPGAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcggtcggactgtcgagcagcgacctg
acccagctcaagttcctgtgccggaaccgcgttagcaagaggaagctggagctcgcgcag
agcggcctggacctcttcaccgtcttgctcgagcagaacgagctgagcgccgagcgcacc
gtgctgctgcgcgagctgctcggctccctgcggcgcaaggacctcctgtgcctcctggac
gacttcgaacggggcgcggaggccggggcggcgccggaggagcgagacctgcgggcagcg
atggagatcatctgtgataacgtggggaaggactggaagaggctggctcgtcgcctcaga
gtgtctgagaccaagattgaagccatcgaggagaagtacccccggaacctggtggagcag
gtgagggagctgctgagggtctggaagaacagcgctagggaggacgcagctgtgtcctgc
ctggtgagcgcgctccggggctgccagctaaacgtggtggcagatctcatcgaggaggac
cagtgggcccaggcccgccagagaaggagcaccagccctggctccctcatggcctgggac
tcaggctccgctgccccgggagcctcctga

DBGET integrated database retrieval system